KEGG   Capra hircus (goat): 102188120
Entry
102188120         CDS       T02910                                 

Gene name
APLN
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
chx  Capra hircus (goat)
Pathway
chx04080  Neuroactive ligand-receptor interaction
chx04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102188120 (APLN)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102188120 (APLN)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 102188120
NCBI-ProteinID: XP_017899775
UniProt: A0A2H4H7K9
Position
X
AA seq 77 aa
MNLRLCVQALLLLWLCLNAVCGGPLLQTSDGKEMEEGTIRYLVQPRGARSGPGPWQGGRR
KFRRQRPRLSHKGPMPF
NT seq 234 nt   +upstreamnt  +downstreamnt
atgaatctgcggctctgcgtgcaggcgctcctgctgctctggctttgcctgaacgcggtg
tgcggaggacccctgctgcagacatctgacgggaaggagatggaagaaggcaccatccgc
tacctggtgcagcccaggggagcgaggagcggcccagggccctggcagggaggtcggagg
aagttccggcgccagcggccacgcctctcccacaagggccccatgcctttctga

DBGET integrated database retrieval system