KEGG   Capra hircus (goat): 102189279
Entry
102189279         CDS       T02910                                 

Gene name
ASIC1
Definition
(RefSeq) acid sensing ion channel subunit 1
  KO
K04829  acid-sensing ion channel 1
Organism
chx  Capra hircus (goat)
Pathway
chx04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:chx00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102189279 (ASIC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:chx04040]
    102189279 (ASIC1)
Ion channels [BR:chx04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   102189279 (ASIC1)
SSDB
Motif
Pfam: ASC EFP
Other DBs
NCBI-GeneID: 102189279
NCBI-ProteinID: XP_017903299
UniProt: A0A452G5G4
Position
5
AA seq 526 aa
MELKAEEEEVGGLQPVSIQAFASSSTLHGLAHIFSYERLSLKRALWALCFLGSLAVLLCV
CTERVQYYFHYHHVTKLDEVAASQLTFPAVTLCNLNEFRFSQVSKNDLYHAGELLALLNN
RYEIPDTQMADEKQLEILQDKANFRSFKPKPFNMREFYDRAGHDIRDMLLSCHFRGEVCS
AEDFKVVFTRYGKCYTFNSGRDGRPRLKTMKGGTGNGLEIMLDIQQDEYLPVWGETDETS
FEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVACQEQRLIYLPPPWGTCKAVTMDLDFF
DSYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDQEYCV
CEMPCNLTRYGKELSMVKIPSKASAKYLAKKFNKSEQYIGENILVLDIFFEVLNYETIEQ
KKAYEIAGLLGDIGGQMGLFIGASILTVLELFDYAYEVIKHKLCRRGKCQKEAKRSSADK
GVALSLDDVKRHNPCESLRGHPAGMTYAANILPHHPARGTFEDFTC
NT seq 1581 nt   +upstreamnt  +downstreamnt
atggaactgaaggctgaggaggaggaggtgggtggcctccagccggtgagcatccaggcc
ttcgccagcagctccaccctgcacggcctggcccacatcttctcctacgagcggctgtct
ctgaagcgggcgctctgggccctctgcttcctgggctccttggctgtgctgctgtgtgtg
tgcaccgagcgtgtgcagtactacttccactaccaccacgtcaccaagctcgacgaggtg
gctgcctcccagctcaccttccctgccgtcacgctgtgcaacctcaacgagttccgcttt
agccaagtctccaagaatgacctgtaccacgccggggagctgctggccctgctcaacaac
aggtatgagataccagacacgcagatggcagatgaaaagcagctggagatactgcaggac
aaggccaactttcgcagcttcaagcccaagcccttcaacatgcgcgagttttatgaccgc
gcagggcacgacatccgagacatgctgctttcctgccacttccggggggaggtctgcagc
gctgaggacttcaaggtggtcttcacgcggtatggaaagtgctacacgttcaactctggc
cgagatgggcgcccacggctgaagaccatgaagggtgggacgggcaacgggctggagatc
atgctggacattcagcaggacgagtacctgcccgtgtggggggaaaccgatgagacgtcc
ttcgaagcaggcatcaaagtgcagatccacagtcaggatgaacctcccttcatcgaccag
ctgggcttcggcgtagccccagggttccagacctttgtggcctgccaagagcagcggctc
atctacctgcccccgccctggggcacctgcaaagctgttaccatggacttggatttcttc
gactcctacagcattaccgcctgccgcatcgactgtgagacgcgctacctggtggagaac
tgtaactgccgcatggtgcacatgccaggggacgccccatactgcactccagagcagtac
aaggagtgtgcagatcctgctctggacttcctggtggagaaggaccaggagtactgtgtg
tgtgaaatgccctgcaacctgacccgctatggcaaggagctgtccatggtcaagatcccc
agcaaagcatcagccaaatacttggccaagaagttcaacaagtctgagcagtacataggg
gagaacatcctggtgctggacattttctttgaagtcctcaactatgagaccattgagcag
aagaaggcctatgagattgcagggctcctgggtgacattggaggccaaatggggctgttc
atcggggccagcatcctcacggtgctggaactctttgactacgcctatgaggtcataaaa
cacaagctgtgcagaagagggaagtgccagaaggaggccaaacggagcagcgcggacaag
ggcgtggccctcagcctggatgacgtcaaaagacacaacccgtgcgagagcctccggggc
catcctgccgggatgacgtatgcggccaacatcctacctcaccatccggcccgaggcact
tttgaggactttacctgctga

DBGET integrated database retrieval system