KEGG   Capra hircus (goat): 102189634Help
Entry
102189634         CDS       T02910                                 

Gene name
CXCR1
Definition
(RefSeq) C-X-C motif chemokine receptor 1
  KO
K04175  C-X-C chemokine receptor type 1
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04061  Viral protein interaction with cytokine and cytokine receptor
chx04062  Chemokine signaling pathway
chx04072  Phospholipase D signaling pathway
chx04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    102189634 (CXCR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102189634 (CXCR1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102189634 (CXCR1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102189634 (CXCR1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    102189634 (CXCR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:chx04030]
    102189634 (CXCR1)
   04050 Cytokine receptors [BR:chx04050]
    102189634 (CXCR1)
   04090 CD molecules [BR:chx04090]
    102189634 (CXCR1)
G protein-coupled receptors [BR:chx04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    102189634 (CXCR1)
Cytokine receptors [BR:chx04050]
 Chemokine receptors
  CXC Chemokine
   102189634 (CXCR1)
CD molecules [BR:chx04090]
 Proteins
  102189634 (CXCR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 DUF621
Motif
Other DBs
NCBI-GeneID: 102189634
NCBI-ProteinID: XP_005676587
UniProt: A0A452EAF1
Position
2
AA seq 368 aa AA seqDB search
MVGDSVFQSDHTMTIILKDLSNSSYLWEGFEDYSGTPPTEEFDYSPCEISTETLNKYAVV
VIYALVFLLSLLGNSLVMLVILYSRVGRSVTDVYLLNLAMADLLFAMTLPIWAASKAKGW
IFGTPLCKVVSLLKEVNFYSGILLLACISMDRYLAIVHATRTLTQKRHWVKFICLGIWAL
SVILALPIFIFREAYQPPSSNLVCYEHLGANTTKWRMVMRVLPQTFGFLLPLLVMLFCYG
LTLRTLFSAQMGQKHRAMRVIFAVVLVFLLCWLPYNLVLIADTLMRAQVITETCQRRNDI
GRALDATEILGFLHSCLNPLIYVFIGQKFRHGLLKIMAIHGLISKEFLAKDGRPSFVGSS
SGNTSTTL
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggttggtgactcagtctttcaatcagatcacaccatgacaatcatcctgaaagattta
tctaatagcagttatttgtgggaggggtttgaggattacagcggcacgccacccacagaa
gaatttgattatagtccctgtgagataagcactgagacactcaacaagtatgctgtggtc
gtcatctatgccctggtcttcttgctaagcctcctgggaaactccctggtgatgctggtc
atcttgtacagccgggtcggtcgctctgtcactgatgtctacctgctgaacctggccatg
gctgacctgctcttcgccatgaccttgcctatctgggccgcctccaaggcaaagggctgg
atcttcggcacacccctgtgcaaggtggtctcactcctgaaggaagtcaacttctacagc
ggtattctactgctggcctgcatcagcatggaccgctacctggccattgtccatgctaca
cgcacgctgacccagaagcggcactgggtcaagttcatatgtttaggcatctgggccctg
tccgtgatcctggccctgcccatcttcatcttccgtgaggcctatcaaccaccctcctcc
aacctagtctgctacgagcacctgggtgccaatacaacgaaatggcgtatggtgatgagg
gtcctgccccagacttttggcttcctcctgcccctgctggtcatgcttttctgctacgga
ctcaccctgcgcacactgttttcagcccaaatggggcagaagcaccgggccatgcgggtc
atctttgctgtcgtgctcgtcttcctgctctgctggctgccctacaacctggtcctgatc
gcagacaccctcatgagggcccaggtgatcaccgagacctgtcagcgccgcaacgacatt
ggccgggccctggacgccaccgagatcctgggcttcctgcacagctgcctcaaccctctc
atctatgtcttcattggccagaagtttcgccacggactcctcaagatcatggccatccat
ggcttgatcagcaaggagttcttggccaaggatggcaggccttcctttgttggctcttct
tcagggaacacgtctactaccctctga

DBGET integrated database retrieval system