KEGG   Capra hircus (goat): 102190288Help
Entry
102190288         CDS       T02910                                 

Gene name
UGT1A1
Definition
(RefSeq) UDP-glucuronosyltransferase 1-1
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
chx  Capra hircus (goat)
Pathway
chx00040  Pentose and glucuronate interconversions
chx00053  Ascorbate and aldarate metabolism
chx00140  Steroid hormone biosynthesis
chx00830  Retinol metabolism
chx00860  Porphyrin and chlorophyll metabolism
chx00980  Metabolism of xenobiotics by cytochrome P450
chx00982  Drug metabolism - cytochrome P450
chx00983  Drug metabolism - other enzymes
chx01100  Metabolic pathways
chx05204  Chemical carcinogenesis
Module
chx_M00014  Glucuronate pathway (uronate pathway)
chx_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:chx00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    102190288 (UGT1A1)
   00053 Ascorbate and aldarate metabolism
    102190288 (UGT1A1)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    102190288 (UGT1A1)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102190288 (UGT1A1)
   00860 Porphyrin and chlorophyll metabolism
    102190288 (UGT1A1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102190288 (UGT1A1)
   00982 Drug metabolism - cytochrome P450
    102190288 (UGT1A1)
   00983 Drug metabolism - other enzymes
    102190288 (UGT1A1)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    102190288 (UGT1A1)
Enzymes [BR:chx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     102190288 (UGT1A1)
Glycosyltransferases [BR:chx01003]
 Others
  Hydrophobic molecule
   102190288 (UGT1A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C
Motif
Other DBs
NCBI-GeneID: 102190288
NCBI-ProteinID: XP_005678803
Position
3
AA seq 533 aa AA seqDB search
MTAGSQGERPVILLLLLCTLGPSVSQAGKLLVVPVDGSHWLSLVGPLQPLQQRGHDIVVL
APDASVYIKEEAFYTLKRYPVPFQREDLEETFISLGRTVFEDDPFLKRVIKTYQKIKKDS
ALLLSACSHLLHNKELMASLTASSFDAVLTDPFLPCGPIVAQYLSVPAVFFLNGLPCGLD
FQGTQSPSPPSYVPRYLSFNSDHMTFLQRVKNMFITLSESFLCDVVYSPYRLLASEFLQK
DMTVQDLMSSGSVWLLRNDFVFNFPRPIMPNIVFVGGINCASKKPLSQEFEAYVNASGEH
GIVIFSLGSMVSEIPEQKAMEIADALGKIPQTVLWRYTGTPPPNLAKNTKLVKWLPQNDL
LGHPKTRAFITHSGSHGVYEGICNGVPMVMMPLFGDQMDNAKRMETRGAGITLNVLEMSS
EDLENALKAVINEKSYKENIMRLSRLHKDRPIEPLDLAVFWVEFVMRHKGASHLRPAAHD
LTWYQYHSLDVIGFLLAITLTVIFITFKACAFTFRKCFGKKERVKKSHKSKTH
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgacagcagggtcccagggggaacgcccagtcatcctgctcctgctgctgtgcacgctc
ggcccctctgtgtcccaggctgggaagctgctggtggtcccggtagatggcagccactgg
ctgagtttggttggacccctccagcccctgcagcagaggggacatgacatagtggtcctg
gcacctgacgcctctgtgtacattaaagaggaagcattttacaccttgaagaggtaccct
gtgccattccaaagggaggacttggaagagacttttatcagcctcgggcgtactgttttt
gaggatgatcctttcttgaagcgcgtgatcaaaacataccagaaaatcaaaaaggactcg
gctctgctcttatccgcctgctcccacttactgcacaacaaggagctgatggcctccctg
acggcaagtagcttcgatgccgttttgacagaccctttccttccctgcggccccatcgtg
gcccagtacctgtctgtgcctgctgtgttcttcttgaatggactgccatgtggcctggac
tttcagggtacccagagccccagtccaccatcctacgtgcccaggtatctgtcctttaac
tcagatcacatgaccttcctgcagcgggtgaagaacatgttcatcaccttgtcagagagt
ttcctgtgcgatgtggtttattccccgtacaggctacttgcctccgaattccttcagaaa
gacatgactgttcaggatctcatgagctctgggtctgtctggcttctcagaaatgacttt
gtgtttaatttcccgaggcccatcatgcccaacatagtgtttgttggtgggatcaactgt
gctagcaaaaagccactctctcaggaatttgaagcctatgtaaatgcttctggagaacat
ggaattgtgattttctctttgggctcaatggtctcagagattccggagcagaaagctatg
gaaattgctgatgctttgggcaaaatacctcagacagtcctgtggcggtacactgggact
ccaccaccgaatcttgcgaagaatacgaaacttgtcaagtggctgccccaaaatgatttg
cttggtcacccaaagactcgggcctttatcacacattccggctcccatggcgtttatgaa
ggaatatgcaatggcgttcccatggtgatgatgcccttgtttggtgatcagatggacaat
gcaaagcgcatggagacccggggagctggaataaccttgaatgtcctggaaatgagttcg
gaagatttagaaaatgccctgaaagctgtcatcaatgaaaaaagctataaggaaaacatc
atgcgcctctccagacttcacaaggaccgccccatagagcctctggacctggctgtattc
tgggtggagtttgtgatgaggcacaagggggcatcccacctgcgccctgcagcccatgac
ctcacctggtaccagtaccactctctggatgtaattggcttcctcctggcgatcacgctg
acagtcatcttcatcacctttaaggcctgtgcctttaccttccggaaatgctttgggaag
aaagagcgagtgaagaaatctcataaatccaagacacactga

DBGET integrated database retrieval system