KEGG   Capra hircus (goat): 102191674Help
Entry
102191674         CDS       T02910                                 

Gene name
EIF3A
Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit A
  KO
K03254  translation initiation factor 3 subunit A
Organism
chx  Capra hircus (goat)
Pathway
chx03013  RNA transport
Brite
KEGG Orthology (KO) [BR:chx00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    102191674 (EIF3A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:chx03012]
    102191674 (EIF3A)
Translation factors [BR:chx03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    102191674 (EIF3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI
Motif
Other DBs
NCBI-GeneID: 102191674
NCBI-ProteinID: XP_017896822
UniProt: A0A452EWF9
Position
26
AA seq 1368 aa AA seqDB search
MPAYFQRPENALKRANEFLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVD
LRKSHLAKEGLYQYKNICQQVNIKSLEDVVRAYLKLAEEKTEAAKEESQQMVLDIEDLDN
IQTPESVLLSAVSGEDTQDRTDRLLLTPWVKFLWESYRQCLDLLRNNSRVERLYHDIAQQ
AFKFCLQYTRKAEFRKLCDNLRMHLSQIQRHHNQSTAINLNNPESQSMHLETRLVQLDSA
ISMELWQEAFKAVEDIHGLFSLSKKPPKPQLMANYYNKVSTVFWKSGNALFHASTLHRLY
HLSREMRKNLTQEEMQRMSTRVLLATLSIPITPERTDIARLLDMDGIIVEKQRRLATLLG
LQAPPTRIGLINDMVRFNVLQYVVPEVKDLYNWLEVEFNPLKLCERVTKVLNWVREQPEK
EPELQQYVPQLQNNTILRLLQQVAQIYQSIEFSRLTSLVPFVDAFQLERAIVDAARHCDL
QVRIDHTSRTLSFGSDLNYATREDAPIGPHLQSMPSEQIRNQLTAMSSVLAKALEVIKPA
HILQEKEEQHQLAVTAYLKNSRKEHQRILARRQTIEERKERLESLNIQREKEELEQREAE
LQKVRKAEEERLRQEAKEREKERILQEHEQIKKKTVRERLEQIKKTELGAKAFKDIDIED
LEELDPDFIMAKQVEQLEKEKKELQERLKNQEKKIDYFERAKRLEEIPLIKSAYEEQRIK
DMDLWEQQEEERITTMQLEREKALEHKNRMSRMLEDRDLFVMRLKAARQSVYEEKLKQFE
ERLAEERHNRLEERKRQRKEERRITYYREKEEEEQRRAEEKMLKEREERERAERAKREEE
LREYQERVKKLEEVERKKRQRELEIEERERRREEERRLGDDSLSRKDSRWGERDTEGTWR
KGPETDSEWRRGPPEKEWRRGEGRDEERPHRRDDDRPRRLGDDEERESSLRPDDDRIPRR
AMDDDRGPRRGPDEDRFSRRAADDDRPSWRSADDDRPPRRIGDEDRGSWRHADDDRPPRR
GLDEDRGSWRTADEDRGPRRGLDEDRGPRRGGADDERSSWRNADDDRPRRGLDDDRGPRR
GLDDDRGPWRNTDDDRFSRRGADDDRFSRRGADDDRGPWRNMDDDRISRRADDDRIPRRG
DDSRPGPWRPFVKPGGWREKEKAREESWGPPRDSRPSEDREWEREKERDRDNQDRDENDR
DPERERDRERERDRERDGDRDDRFRRPRDEGGWRRGPAEESSSWRDASRRDDRDRDDRRR
ERDDRRDLRDRRDDRDRRGPPLRSEREEVSSWRRADDRKDDRAEERDTPRRVPPAALSRD
RDRDRDRDRDREREGEKEKTSWRAEKDRESLRRTKNETDEDGWTTVRR
NT seq 4107 nt NT seq  +upstreamnt  +downstreamnt
atgccggcctatttccagaggccggaaaatgccctcaagcgcgccaacgagtttcttgaa
gttggcaaaaagcaacctgctttggacgttctttatgatgttatgaaaagtaagaaacat
agaacatggcaaaagatacacgagccgattatgttgaaatacttggaactttgtgtggat
cttcgcaagagccatttggctaaagaaggcttatatcagtataagaacatttgtcaacag
gtgaacatcaaatctctagaggatgttgttagggcatatttgaaattggcagaggagaaa
acggaagctgctaaagaagagtcccagcagatggtcttagacatagaagatctggataat
attcaaactcctgagagtgttctcctaagtgctgtaagtggtgaagacactcaggatcgt
actgacagattacttttaactccatgggttaaattcctgtgggaatcatacagacagtgt
ttggaccttcttcgaaacaattctagagtagagcgtctctaccatgatattgcccaacaa
gctttcaagttctgcctccaatacacccggaaggctgaattccgtaagttgtgtgacaac
ttgagaatgcacttgtctcagattcaacgccaccataaccaaagtacagcaatcaacctt
aataatccagagagccagtccatgcatttggaaaccaggcttgttcagttggacagtgct
atcagcatggaattgtggcaggaagcattcaaagctgtggaagatatccatgggctattt
tccttatctaaaaaaccgcccaagcctcagttgatggcaaattactataacaaagtctca
actgtattttggaaatctggaaatgctctttttcatgcgtctaccctccatcgtctttac
catttatctagagaaatgagaaagaatcttacacaagaagagatgcaaagaatgtctact
agagtccttttggccactctttccatccctattacccctgagcgtactgatattgcccga
cttctggatatggacggcattatagttgagaaacagcgtcgccttgcaaccctgctaggc
ctgcaagccccaccaacgcgaattggccttattaacgatatggtcagattcaatgtgcta
caatatgttgtcccagaagtaaaagacctttacaattggctggaagtcgaatttaaccca
ctaaaactctgtgagagagtcacaaaggttctcaattgggttagggagcaacctgaaaag
gaaccagagttacaacagtatgttccacagctgcagaacaataccatactccggcttctc
cagcaggtggcacaaatttatcagagcattgagttttctcgtttgacttctctggttcct
tttgttgatgctttccaactggaacgggccatagtagatgcagctaggcactgcgacctg
caggttcgtattgaccacacttctcggacccttagttttggatctgatttgaattacgct
actcgagaagatgctccaattggtcctcatctgcaaagcatgccttcagaacagataaga
aatcagctgaccgctatgtcctcagtacttgcgaaagcacttgaagtcattaagccagct
catatcctgcaagagaaagaagaacagcatcagttggctgttaccgcataccttaaaaat
tcacggaaagagcaccagcgtatcttggctcgccgtcagacaattgaggaaagaaaagag
cggcttgagagtctgaatattcagcgtgagaaagaagaactggagcagcgggaagctgaa
ctccagaaagtgcggaaggctgaggaagagaggctgagacaggaggcaaaggagagagag
aaggaacggatcttacaggaacatgaacaaatcaagaagaaaactgttcgtgagcgtttg
gagcaaatcaagaagacagaactgggtgccaaagcattcaaagatattgacattgaagac
cttgaagaattggatcctgatttcatcatggctaaacaggttgaacaactggagaaagaa
aagaaggaacttcaggaacgcctaaagaatcaagaaaagaagattgactactttgaaaga
gctaagcgtttggaagaaatccccttgataaagagtgcttacgaagaacagagaattaaa
gacatggatctgtgggaacaacaagaagaagaaagaattactacgatgcagctggaacgg
gaaaaggctctagaacataagaaccggatgtcacgaatgcttgaagacagagatttattt
gtaatgcggctcaaggcagcacgacagtctgtttatgaggaaaaacttaaacagttcgaa
gagcggttagcagaagaacggcataatcgcttggaagaacgtaaaaggcagcgtaaagaa
gaacgaaggataacctactatagagaaaaagaagaggaagagcagaggagggcagaagaa
aagatgctaaaagagcgagaagagcgagagcgggctgagcgcgcgaagcgtgaggaggag
ctacgggaataccaggagcgggtcaagaagctagaagaagttgaaaggaaaaaacgtcag
agggagttggaaattgaagaaagggagcgtcgtagagaggaggagaggcgacttggtgat
gactcactttctagaaaggactctcgttggggagagagagatacagaaggcacttggaga
aaaggacctgaaacagattctgagtggagaagaggccctccagagaaggagtggagacgt
ggagaagggcgggacgaagagagacctcacagaagagacgacgaccgaccgaggcgcctg
ggggatgatgaagagagagagtcctctcttagaccagatgatgatcgcattccccgacgt
gccatggatgatgacagaggcccacgacgtggtcctgatgaagatcggttctctcgcagg
gcggcggacgatgaccggccttcttggcgtagtgcagacgatgacaggcctcccagacga
attggagatgaagacaggggtagctggcgtcacgcagatgacgacagaccacctagacga
gggctggatgaggacagaggaagctggcgcacggctgatgaggacagaggacccaggcga
gggctggacgaggaccgggggccgcgccgaggaggtgcagacgatgagcgttcgtcctgg
aggaatgctgacgatgatcgtcccaggcggggcttggatgatgaccggggtcccaggcgg
ggcttggatgatgatcgaggaccgtggcggaatacagacgatgatagattttccaggcgc
ggtgcagatgatgacagattttccaggcgcggtgcagatgatgacagggggccttggaga
aacatggatgacgatcggatctcaagacgggctgatgacgatcggattcccagaaggggt
gatgattcacgacctggtccctggagaccatttgtcaaaccaggtggatggagagagaaa
gaaaaagccagagaagagagttggggtccacctcgagactcgagaccatcagaagaccgt
gaatgggagagggaaaaagagagagaccgagataatcaagatcgagacgagaacgacagg
gacccggagagagaaagagacagagagagagagagagacagagagagagatggtgatcga
gatgaccgcttcagacggccaagggatgaaggtggctggagaagaggaccagctgaggag
tcttcaagctggagagatgcaagtcgtcgtgacgatagggaccgcgatgaccggcgtcgt
gagagagatgatcgccgtgatctgagggacagacgagacgacagggaccgaagaggaccg
cctctcagatccgagcgtgaggaagtaagttcttggagacgtgctgatgacaggaaagat
gaccgggccgaagagcgggatacccctcgtcgtgttcctcccgcagctctttcgagagat
cgagatcgagaccgagaccgagaccgagaccgagaaagggaaggtgagaaagagaagacc
tcctggagagctgagaaagatagggaatctcttcgtcgtactaaaaatgagactgatgaa
gatggatggaccacagtacgacgttaa

DBGET integrated database retrieval system