KEGG   Carboxydothermus hydrogenoformans: CHY_1355Help
Entry
CHY_1355          CDS       T00287                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
chy  Carboxydothermus hydrogenoformans
Pathway
chy00071  Fatty acid degradation
chy00280  Valine, leucine and isoleucine degradation
chy00310  Lysine degradation
chy00362  Benzoate degradation
chy00620  Pyruvate metabolism
chy00630  Glyoxylate and dicarboxylate metabolism
chy00640  Propanoate metabolism
chy00650  Butanoate metabolism
chy00720  Carbon fixation pathways in prokaryotes
chy00900  Terpenoid backbone biosynthesis
chy01100  Metabolic pathways
chy01110  Biosynthesis of secondary metabolites
chy01120  Microbial metabolism in diverse environments
chy01130  Biosynthesis of antibiotics
chy01200  Carbon metabolism
chy01212  Fatty acid metabolism
chy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:chy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CHY_1355 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    CHY_1355 (atoB)
   00640 Propanoate metabolism
    CHY_1355 (atoB)
   00650 Butanoate metabolism
    CHY_1355 (atoB)
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    CHY_1355 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CHY_1355 (atoB)
   00072 Synthesis and degradation of ketone bodies
    CHY_1355 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CHY_1355 (atoB)
   00310 Lysine degradation
    CHY_1355 (atoB)
   00380 Tryptophan metabolism
    CHY_1355 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CHY_1355 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CHY_1355 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CHY_1355 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:chy04147]
    CHY_1355 (atoB)
Enzymes [BR:chy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CHY_1355 (atoB)
Exosome [BR:chy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CHY_1355 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABB15584
UniProt: Q3ACE6
Position
1213541..1214722
Genome map
AA seq 393 aa AA seqDB search
MEEVVIVSAVRTPIGSFLGSLAQTPAVDLGALVIKESLNRINLAPRFVDEVIMGNVLQAG
LGQNPARQAAIKAGIPQEVPAFTVNKVCGSGLKSVGLAYQAIATGDADIVVAGGMENMSL
APYVLPKARTGYRMGHDTLIDSMIKDGLWCAFTDVHMGITAENIAEKYNITREEQDKFAL
QSQERAIKAIDEGKFKEEIVPVIIPQKKGEPLVFSTDEFPKRGTSLEKLAALKPAFKKDG
TVTAGNASGINDGAAAVVVMSAKKAQELNIKPLAVIRGYAAAGVDPAYMGLGPIPATRKA
LKKANLTVSDLGLIEANEAFAAQALAVIKELELNPEITNVNGGAIALGHPIGASGARILV
TLLHEMQKRNTKYGLATLCIGGGQGFALVVEKV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagttgtaatagttagtgccgttagaactcccattggcagttttttgggtagc
cttgcccaaactccggcagtggatttgggagcgcttgttattaaagaaagtctaaaccgc
attaaccttgcgccccggtttgtcgatgaggttatcatgggaaacgttttgcaggcagga
ttaggccagaacccagcccggcaggcagctataaaagcaggaataccccaggaagtacct
gcttttacagtaaacaaagtttgcggttcaggattaaaatccgtcggactggcttatcag
gcaatagcaacaggtgatgccgatatcgttgtcgccgggggaatggaaaacatgtcttta
gcaccttacgtcttgcccaaagccaggacaggttaccgcatggggcatgataccctgata
gattccatgattaaagatggcttatggtgtgcttttaccgatgtgcatatgggtattacc
gcggaaaatatagccgaaaaatacaatataacccgcgaagaacaggataaatttgccctg
caaagtcaggaaagagctataaaagcaattgatgaaggaaagtttaaagaagaaatcgtt
cccgtaatcatcccccagaaaaaaggagaacccctggtattttccaccgatgaatttccc
aaacgcggtacatccctggaaaaacttgccgctctaaaaccggccttcaaaaaagatggt
accgtaactgccggaaatgcctcgggaattaacgatggagctgctgcggttgtagttatg
tcagcaaaaaaagctcaagagttaaatattaaacccttggctgttatccgcggttatgca
gctgcgggagtagatcctgcctatatgggtttaggcccaatacctgccacccgcaaagcc
cttaaaaaagccaatttaaccgtttcggacttggggcttattgaagcaaacgaagctttt
gccgcccaggctttagcggtaattaaagagctcgaattaaatccggaaataactaatgtc
aacggtggtgccatagcgttaggtcaccccataggagcctcgggagctcgaatattggta
accttattacatgagatgcaaaaacgtaatacaaaatacggtttagcaaccttgtgtatc
ggtggcggccaaggatttgctttagtagttgaaaaagtttaa

DBGET integrated database retrieval system