KEGG   Carboxydothermus hydrogenoformans: CHY_1878Help
Entry
CHY_1878          CDS       T00287                                 

Gene name
folD
Definition
(GenBank) methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
chy  Carboxydothermus hydrogenoformans
Pathway
chy00670  One carbon pool by folate
chy00720  Carbon fixation pathways in prokaryotes
chy01100  Metabolic pathways
chy01120  Microbial metabolism in diverse environments
chy01200  Carbon metabolism
Module
chy_M00140  C1-unit interconversion, prokaryotes
chy_M00377  Reductive acetyl-CoA pathway (Wood-Ljungdahl pathway)
chy_M00618  Acetogen
Brite
KEGG Orthology (KO) [BR:chy00001]
 09100 Metabolism
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    CHY_1878 (folD)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CHY_1878 (folD)
Enzymes [BR:chy01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     CHY_1878 (folD)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     CHY_1878 (folD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: THF_DHG_CYH_C THF_DHG_CYH
Motif
Other DBs
NCBI-ProteinID: ABB15843
UniProt: Q3AAY6
Position
complement(1683992..1684855)
Genome map
AA seq 287 aa AA seqDB search
MAERLTGKPVADAIKEELKGRVADLKAKGIVPKLGIVRVGARPDDLYYEGGAKKTCESIG
MDYEVFEYPQDIDQESFEKAIIEIGAKKDIHGILMFSPLPKHLNERKIRSLIPVEKDVDS
LTLGSAGKVFADDPTGFPPCTPTAVMEILKYYNIPLEGKRAVVLGRSLVVGKPAAILLLR
ENATVTICHSRTKNLPDVCREADILVAAVGRAKMVKEDYVKPGMVVIDVGINEDPDNPGK
YCGDVDFDKVEPIVDKITPVPGGVGSVTTAVLCKHTVKACEILNGLV
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaagacttaccggtaaaccggtggccgatgcaattaaagaggagttaaaagga
agggtagccgatttaaaggctaaggggattgtgccgaaacttggcattgtccgggttgga
gcccggcccgatgacctctactatgagggtggcgccaagaaaacctgtgaatctatcggc
atggattacgaggtgtttgaatatccccaagatatcgatcaggagtcctttgaaaaagcc
attatcgaaattggagcaaagaaggatatccacggtattctcatgtttagcccgctgccc
aaacatttaaacgagcggaaaatccgctccctgattcccgtggaaaaggacgtggattcc
cttactttaggcagtgccgggaaagtttttgccgatgaccctaccggctttccgccctgt
acgcctacggcggtcatggaaatacttaaatattacaacatacctttggagggtaagaga
gcggttgtccttggtcgttctctggtggtgggcaaacctgcggctattcttcttctgcgg
gaaaatgctaccgtcaccatctgtcattcccgcaccaagaatctaccggacgtatgccgg
gaagcggatattttggtggcggcagtgggccgggccaagatggtaaaagaagattatgtt
aagcccgggatggtagttatagatgtaggcatcaatgaagacccggacaatcccggcaag
tactgcggcgatgtggattttgacaaagtagagccgattgttgacaagattaccccggtt
cctggtggagtgggttcggtcacgacggcggtattgtgcaagcacaccgttaaagcctgc
gaaattttaaatggcctggtttaa

DBGET integrated database retrieval system