KEGG   Campylobacter hyointestinalis: CHH_0389Help
Entry
CHH_0389          CDS       T04651                                 

Gene name
bioF
Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
chyo  Campylobacter hyointestinalis
Pathway
chyo00780  Biotin metabolism
chyo01100  Metabolic pathways
Module
chyo_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:chyo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CHH_0389 (bioF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:chyo01007]
    CHH_0389 (bioF)
Enzymes [BR:chyo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     CHH_0389 (bioF)
Amino acid related enzymes [BR:chyo01007]
 Aminotransferase (transaminase)
  Class II
   CHH_0389 (bioF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP ResIII
Motif
Other DBs
NCBI-ProteinID: ANE32092
UniProt: A0A172SPI6
Position
complement(356102..357208)
Genome map
AA seq 368 aa AA seqDB search
MFDIKKAKEQENFREIKKTRTHSKFIEINGKTLLNLGSNDYLGIATNANLKNEFLEICKD
KDWFFGSGASRLVYSANEEFDKLESWFETKFNSKKAVIFNSGYCANLSCISALNGDKTLF
LADKLIHASMIDALKLANANFKRFAHNDNEALEDLLKQNSDKFDHIIILTEAVFSMDGDS
ADIEFIVNLKKTYQNVLIYVDEAHSFFVKSQLGLSAELGLDRQIDFLLVTLGKGVGSSGA
AMISSNEFKDIFVNSARSLIFSTAIPPINVAWTNFVLSKDHSIQRANLKEIIKFLGISDS
HISPFIVGENKKALALSQKLFEAGYFIPAIRPPTVPLGKSRLRISLRGDILSEDLLNLKE
ILDENRSN
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgtttgatataaaaaaagcaaaagaacaagaaaatttcagagagatcaaaaagacaagg
acacattctaaatttatcgaaattaatggcaaaacacttctaaatttaggaagtaacgat
tatctaggtatagccacaaacgcaaatttaaaaaacgaatttctagaaatttgcaaagat
aaagattggttttttggttcaggagcaagtaggctagtttatagcgcaaatgaagaattt
gacaagctagagagctggtttgagactaaatttaattccaaaaaagcggtgattttcaac
tctggatattgtgcaaatctcagctgcatctcagctctaaatggtgataaaacgctattt
ttagcagataaactaatccacgctagtatgatagatgctctaaaacttgcaaatgcaaat
tttaaaagatttgctcacaatgataatgaagcgctagaagatttactcaaacaaaacagc
gataaatttgatcacatcatcatactaacagaagcggtatttagtatggacggagacagc
gctgatatagaatttattgtaaatttaaaaaagacttaccaaaatgttttgatttacgtc
gatgaagcgcactcgttttttgtcaagtcacagcttgggcttagtgcagagctggggctt
gataggcagatcgattttttgttagtaactcttggaaaaggcgtcggaagtagtggcgca
gcgatgataagtagtaatgaatttaaagatatttttgtaaatagcgctagaagtcttatc
ttttcaacagcgattccacctataaatgtagcttggacgaattttgttttgagtaaagac
cacagcatccaaagagcaaatttaaaagaaattatcaaatttttagggataagcgatagt
catatcagcccttttatagtcggtgaaaacaaaaaggcacttgcactttcacaaaagctt
tttgaagcaggatatttcataccggcgattcgtccgccgactgttccacttggaaaatca
agacttcgcataagcttaaggggcgatattttaagtgaagatttattaaatttaaaagag
attttagatgaaaatagatctaattaa

DBGET integrated database retrieval system