KEGG   Campylobacter hyointestinalis: CHH_1651Help
Entry
CHH_1651          CDS       T04651                                 

Gene name
ubiX
Definition
(GenBank) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
chyo  Campylobacter hyointestinalis
Pathway
chyo00130  Ubiquinone and other terpenoid-quinone biosynthesis
chyo01100  Metabolic pathways
chyo01110  Biosynthesis of secondary metabolites
chyo01120  Microbial metabolism in diverse environments
chyo01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:chyo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    CHH_1651 (ubiX)
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    CHH_1651 (ubiX)
Enzymes [BR:chyo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     CHH_1651 (ubiX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: ANE33258
UniProt: A0A172STA7
Position
complement(1609538..1610083)
Genome map
AA seq 181 aa AA seqDB search
MKILVGITGASGTHLGLNLANMVSNLGHEVHLIISENAKISMKKEGFDTDDLNPNVITHQ
NGEIYSSAASGSSRFDKMIVVPCSINTLAKISCSLADNLIARAAAVMLKEHKTLILAVRE
MPFSAISLRQMSELSALGVIIAPPVLAYYSCPKNLDEMENFIIGKWLDLLCIEHDIFRRW
N
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatactagtaggtataacaggagctagtggtacacatctgggtttaaatctagca
aatatggtatcaaatttaggtcacgaagttcatctcatcatcagtgaaaatgcaaaaatt
tctatgaaaaaagaaggttttgatacagatgatctaaatccaaatgttatcacgcatcaa
aatggtgaaatttattcaagcgcggctagcggttcatctaggtttgataagatgatagtt
gtgccttgtagcatcaacactctagctaaaatttcttgctctttggcggacaatctcata
gcaagagccgccgctgttatgttaaaagagcataaaacccttattttggctgtgcgcgaa
atgccattttcggctatatctcttcgtcaaatgagcgaattatcagccttaggagtcatc
atcgcgccgcctgttttagcgtattattcatgtccaaagaaccttgatgaaatggaaaac
tttataatcggtaagtggttagatctgctttgcatagaacacgatatatttaggcgttgg
aattaa

DBGET integrated database retrieval system