KEGG   Chryseobacterium sp. StRB126: CHSO_4796Help
Entry
CHSO_4796         CDS       T03602                                 

Definition
(GenBank) phosphopantothenoylcysteine decarboxylase/phosphopantothenate-cysteine ligase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
chz  Chryseobacterium sp. StRB126
Pathway
chz00770  Pantothenate and CoA biosynthesis
chz01100  Metabolic pathways
Module
chz_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:chz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    CHSO_4796
Enzymes [BR:chz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     CHSO_4796
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     CHSO_4796
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein NAD_binding_7 F420_oxidored UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: BAP33833
UniProt: A0A077KRY4
Position
complement(5462295..5463500)
Genome map
AA seq 401 aa AA seqDB search
MSVSGKKILIAVSGGIAAYKVHFLIRDFIKQGAEVQAIMTPDAEHFVTQLSLATLSKKPV
YSDFYGDNGTWNSHVELALWADVMIVAPCTANTLSKMIHGMCDNLVIATYMSAKCPVFIA
PAMDLDMYAHPSTKRNLELAESYGHIIIPAENGELASGLIGQGRMSEPATIFNTVENYFT
DHIIEKSLEGKTVLITAGPTYEAIDPVRFIGNHSSGKMGFSLAEEASKRGAKVILISGPS
SQTLTDKNVELHKVTSAKEMLAKVFEFYDRIDIGIASAAVADYAPKDVAKEKIKKNDENL
TIELVKNPDILKTMGEKKTHQFLVGFALETQNEEENAKGKLEKKNLDMIVLNSLRDEGAG
FKNDTNKIKIFTRTEKREFDLKSKDDVAKDILNFVESQLLK
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtttccggtaaaaagatccttattgctgtttctggcggaattgcagcctataaa
gttcactttttgataagagattttataaagcaaggagccgaagtacaggcgattatgacc
cccgatgcagaacattttgtaacccaattaagtttggccacgctatcgaagaagccagtt
tattctgatttttatggtgataacggaacctggaacagccacgtggaacttgctttatgg
gcagacgtgatgattgtggccccatgtacagccaataccttgtctaaaatgatccacgga
atgtgtgataatctcgtgatcgcaacttatatgtctgcaaaatgtccggtatttattgct
ccggcaatggatttggatatgtatgcacacccttccacgaaaagaaatctagaactggca
gaaagctatgggcatattatcattcctgctgaaaacggagaacttgcaagtggtctgatc
gggcagggaagaatgtctgaaccggcaaccatttttaataccgttgaaaattattttaca
gatcatattattgaaaaaagtcttgaaggaaaaacagtcttaattacagcaggacctacc
tatgaggcgattgatccggtaagattcataggaaatcattcctcaggaaaaatggggttt
tccttggctgaagaagcttcaaaaagaggggctaaggtgattctgatctcaggaccaagt
tcccaaacccttaccgataaaaatgtagagctgcataaggtaacttctgcaaaagaaatg
ctggctaaagtatttgagttttatgatagaatagatattgggattgcaagtgctgccgtg
gcagattatgcaccaaaggatgtggctaaggaaaagatcaagaagaatgatgaaaacctt
accattgagctggtgaaaaaccctgatattcttaaaacgatgggagaaaagaaaacccat
cagtttctggtaggatttgctttggaaactcagaatgaagaagaaaatgccaaaggaaaa
ctggaaaagaaaaaccttgatatgattgttttgaattctttacgtgatgaaggagcagga
tttaaaaatgataccaacaagatcaagatattcaccagaacagagaaaagagaatttgat
ctgaagtccaaagatgatgtagcaaaagatattctcaattttgttgaatctcagctttta
aaataa

DBGET integrated database retrieval system