KEGG   Clostridium isatidis: BEN51_08710Help
Entry
BEN51_08710       CDS       T05663                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
cia  Clostridium isatidis
Pathway
cia00260  Glycine, serine and threonine metabolism
cia01100  Metabolic pathways
cia01110  Biosynthesis of secondary metabolites
cia01120  Microbial metabolism in diverse environments
cia01130  Biosynthesis of antibiotics
cia01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cia00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BEN51_08710
Enzymes [BR:cia01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     BEN51_08710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP OKR_DC_1 Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ASW43560
UniProt: A0A343JDF2
Position
1848778..1849818
Genome map
AA seq 346 aa AA seqDB search
MKNFIDLRSDTVTLQPDFMKEAMFKAEVGDDVYGDDTTINELEKLAAEIVGKEAALFVPS
GTFGNQLALFTHCKRGSEVILADSNHIVVHEVGASAIIAGVQLRTIETLNGVITKGDIEK
RIRFEEEDIHFPSTSLICIENAHSSGNVLSLENMKEVYETAKKYNLPVHLDGARIFNAAT
YLNVDVKEIAKYCNSVMFCLSKGLCAPVGSILAGDAEFIKRARKKRKVLGGGLRQAGYLA
AAGIVALKDMTKRLKDDHDNAKFLAEELDKIPDLTVDLNNVKINMVFFKFNKEINTKALT
EYFKKNGIKINDAENGKLRFVTHYWITKENIYKIIKTMKDFLAKSI
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattttatagatttaagaagtgatacagttactctacagccagattttatgaaa
gaagctatgtttaaggcagaagttggtgatgatgtatatggtgatgatactactattaat
gaattagaaaaattagccgcagaaattgttggaaaagaagcagcattatttgttccttct
ggtacctttggaaaccagctagcattatttactcactgcaaaaggggcagcgaagttatt
ttagctgattctaatcatattgttgttcatgaagttggtgcaagtgctataattgcaggc
gtccagcttaggacaatagaaactctaaatggagttattacaaaaggagatattgaaaaa
agaatcagatttgaagaagaagatatccatttcccttcaacttctttaatatgtattgaa
aatgcccattcaagcggaaatgtcctatctctagaaaatatgaaagaagtatatgaaact
gccaaaaaatataatttacctgttcatttagatggagccagaatttttaatgcagctaca
tatttaaatgttgatgttaaagaaatcgccaaatattgtaattctgttatgttctgtctt
tctaagggattatgcgcaccagttggatctattttagctggggatgctgaatttataaaa
agagcaagaaagaaaagaaaagttttaggaggtggacttagacaagccggttatttagct
gcagctggtatagtagccttaaaggatatgactaaaagattaaaagatgatcatgataat
gctaagttccttgcagaggaactagataaaattccagatttaactgttgatttaaataat
gtaaaaattaatatggttttctttaaattcaataaagaaattaatactaaagccttaact
gaatatttcaaaaaaaacggaattaaaatcaatgatgcagaaaatggcaaattgagattt
gtaactcactactggataacaaaagaaaatatttataaaataataaaaactatgaaagac
ttcttagcaaagtctatataa

DBGET integrated database retrieval system