KEGG   Citrus clementina (mandarin orange): CICLE_v10000008mgHelp
Entry
CICLE_v10000008mg CDS       T02982                                 

Definition
(RefSeq) hypothetical protein
  KO
K02365  separase [EC:3.4.22.49]
Organism
cic  Citrus clementina (mandarin orange)
Brite
KEGG Orthology (KO) [BR:cic00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cic01002]
    CICLE_v10000008mg
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cic03036]
    CICLE_v10000008mg
Enzymes [BR:cic01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.49  separase
     CICLE_v10000008mg
Peptidases [BR:cic01002]
 Cysteine Peptidases
  Family C50: separase family
   CICLE_v10000008mg
Chromosome and associated proteins [BR:cic03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   Separase
    CICLE_v10000008mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C50 CHAT
Motif
Other DBs
NCBI-GeneID: 18042497
NCBI-ProteinID: XP_006431949
UniProt: V4V0E7
Position
Unknown
AA seq 2168 aa AA seqDB search
MASASTESSLLSKLETSDSTPIYSFFANYLRPFSDLQNENTKPNPKSKPKAKPNQNLIRP
LAKKFLTFLNNSITILPKRLSNLQSKDDHQTLVDELYDTYRLCLNCLELISSQLACKPYT
IQLQRVRFVCCLVASGKGEDAVREGLRVLETLRRMDFEGKCGDSEFGKVFVEAVAAIVQC
AAVGRSKDCEVYRRVLVLFQEAKCWFRVLDANAHAKLHRVLVSYLGKCTQHLVEEIMCFN
RDLVREFCEATLTEYAKSSMKDQFYKFCRRLCFTLFSLQESKPSLIIEIILCVLDSIACQ
CKVESDNTGIELVELVSYCANKCRTAGTIFCSTVAGHLNHIGGHFPQVITPVDLILRLYA
TGLYLTNYEVKFRGGDLTSTRAAKDEFVLSCLPDDGDQLHNLASLLSALGSYFSFCCAKN
FVSSSVELNLEKKELVSDIEAAYISPQLCSIQDAFYQFFDVFFSQSLASERKRDGLDDNK
RILSVTVAAFILSITMDRKLKKTVLLIKHIIANEWIQPEGLKYLYASLYNIGVLLYRNKQ
VKEASKALKLCCRAAWACVARLSQMFACNCNSDGFHGGMTEGAIVDFVNEACTRSAFLLD
VLHHRGSQKMEKVIVDSLENWSIAAILFKTLPGPLPLVKQWVKIECKRRKNLDVEDDAPT
LYYLLSSSGKVSERTVGIILEQELHSYEELYPLSPELCHRMQMKISTILLQSVYNSRNSY
FQRSGILLRKGRALRARGTEGLKDCIQCLSEAICVMNDISGDMSQHETLHCHQLAVAYCL
RALCTQEAEPNSKQVIEDIGAALNLWLSVSICFESERCNMVSENTMLLLYNVVDLLSLKG
FIEFHNNIYKLMLRLFKCKNVPLEKYLSILWESRRLSHALCISPVNDAFLVNLAEQCGEL
SKSIEFWMGCLQGSQPLLVGFQQSLLFLFANSSHGCYIRKSSVQPCITINDVKEAASELI
SSVPVTPRSVFLVGYLYYDLCERLIANGRLLEALSYAIEAHRLRTQLFQEKFSYSVENSV
KEYNDAGDISQKLHSSPKGFKPSSSVASEVWSFDASSWNVDGCYLSPWNVLQCYLESVLQ
VGIIHELVGNGVEAEAFLLWGKSISCTQSLPQFIVAFSSILGKLYRKKQLWDQAEKELKN
AKQILVEKSINLSCLKCRLILEVTVDQQLGDLSRSYSGCDDRGNTLIERLSNAEKLYKSA
LDKLNLSEWKNSISLPEEARSESILPKKPSIQNVEHGAGNTSVHSTLHQPDTVELTARNQ
LSAKVGGTKCRKTKNALKSLVNDQNLDLDPNSRITRSKCRSSQNQSVNNCVEERSGVSKH
AKNNNLSDLPDILSQGKSVLEAKSFVDTGYQAACICNKMKCWQCLPGEVIESGLLDNLLR
VKWEFTRRRLSLRVLAGIGKCFGNRDQTHEAHKIVFQSVSVLLCRNSFSHTDSSLPVTVL
LDLIGKEYSEDVFAVERAGVLYNLCWFSLKGYCSMKSRNSCCDLSHLQLQKLVSWLMLAF
VLCREAPILFQKVSKLLAVIYVLSSTSKLFSLSSSSKVLSESHWASFFHQASLGTHLNYK
FLSNMSWRFKAQDIVDTEASHVTGSSCIKTETGKLIRISPESIKDLEQFVKDFLLSLPCT
TVICVTLLGGAYTRLLQELLPLPSCVHAWMMLSRFNSINQPIVVLLPVNAVLQEDADYDD
DDAITSFRELREIKDCGKNWHCPWGSTIADDVAPAFKLIMEDNYLSSRSSYGDSLGQRSL
WWNRRTKLDQRLCEFLRKLEDSWLGPWKYMLLGEWSNCKNLDTVHKKLVRDLKCKCKANI
NESLLRIVLGGLKGAFKGEECIAQLCFKKGCYVGTVGYSDNSSCGTSSEASNGVERLSEL
ALQLIHKAVDELEDDSGHREPTILVLDCEVQMLPWENLPILRNHEVYRMPSVGSIAATLE
RIHHHEQLVKGLLATFPLIDPMDAFYLLNPSGDLSETQLLFEDWFRDQNLVGKAGSAPTA
EELTLALKSHDLFIYLGHGSGSQYVSRHDLLKLEKCAATFLMGCSSGSLSLNGCYIPQGT
PLSYLLAGSPVIVANLWDVTDKDIDRFGKTMLDAWLRERSSVPMGCDQCSSVQDEAKNGR
GKVNKKRMLRKKLPETSDISLCNNGCDHRPKLGSFMGQAREACKLPFLIGAAPVCYGVPT
GIRRKPSL
NT seq 6507 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctgcttctaccgaatcgtctctcctctccaaactcgaaacctccgattcaact
ccaatctactctttcttcgccaactatctccgcccgttctcagatctgcaaaacgagaat
acaaaaccaaatccaaaatcaaaaccaaaagcaaaaccgaatcaaaacctaatccgtcca
ctcgccaagaaattcctcacattcctcaacaactccatcaccattctccccaaacgcctc
tccaatttacaatccaaagacgaccaccaaaccctagtcgacgagctctacgacacctac
aggctttgcttgaactgcctggagttaatctcgtcgcagttggcgtgcaagccgtacacg
attcagttgcagagggtgaggttcgtgtgttgccttgtggcgtcggggaagggcgaggat
gccgtgagggaggggcttagggttttggagactcttagaaggatggattttgaagggaag
tgcggtgattcggagtttggtaaggtgtttgtggaggctgtggccgcgatagttcagtgt
gcggccgtgggacggagtaaggattgtgaagtttataggagagtgcttgtcttgttccaa
gaggctaagtgttggttcagggtattagatgcaaatgcacatgcgaagttgcacagggtg
cttgtgtcctatctggggaaatgcactcaacatttggttgaagagatcatgtgttttaat
agagatttggtacgtgaattctgtgaggcaacattgactgaatatgcaaagtcatcaatg
aaagatcaattttacaagttttgtcgtcggctgtgcttcactctgttctcactgcaggag
agtaagccctctcttatcattgaaataatactttgtgtgttggactccattgcctgtcaa
tgcaaggtggaatcggataatactggaatagagctggttgaacttgtctcttattgtgcc
aacaaatgtcgcactgcaggtacaattttttgcagtaccgttgcaggacatctgaatcac
ataggtggtcactttccccaggttataacacctgttgatttgattctgaggctttatgct
actgggttgtacttgaccaactatgaggttaagtttagaggtggtgatttaacatccacc
agagctgcaaaagatgagtttgtgcttagttgtttgcctgatgatggggatcaactgcac
aatttagcttctttgcttagtgcattgggaagttacttttctttttgctgcgccaagaac
tttgtgtcatctagtgtggaattaaatttggagaaaaaagagttagtttctgacattgaa
gctgcttatattagcccacagctctgcagcatacaggatgcattttatcagttttttgat
gtttttttctctcagagccttgcatctgaaagaaagagagatgggcttgatgataataag
agaatacttagtgtgactgtggctgctttcattctttccattacaatggatcgtaaattg
aagaagactgtgcttttgattaagcacatcattgctaatgaatggattcaacctgaaggg
ctaaaatatctatatgcctccctttacaatattggtgtacttctgtacagaaataagcaa
gtgaaggaggcttcaaaggcgttaaaattatgttgtagggctgcatgggcttgtgttgcc
cgtctatcccaaatgtttgcatgcaactgcaactcagatgggttccatggtggcatgaca
gaaggtgctattgtagattttgtaaacgaggcatgtactagaagtgcttttcttctggat
gttctccatcatcgtggcagtcagaagatggaaaaagtaattgtagatagtctggagaat
tggtctattgctgcaattttgtttaaaacactgccaggtcctttgcctttggtgaaacag
tgggttaagatagaatgcaaacgtcgtaagaatttagatgtagaggatgatgctccaact
ttatactatttgctgtcatcttctggaaaagtctcagagaggacggtcggcattatttta
gagcaggagcttcattcatatgaagaattgtatcctttgagcccagaattgtgtcacaga
atgcaaatgaaaatcagtaccatccttctgcaaagtgtgtacaattcaaggaatagttat
tttcagagatcaggaattctactcagaaaaggtagggcattgagggccaggggaactgaa
ggtctgaaggactgtattcagtgtttgtcagaggcaatatgtgttatgaatgacatatct
ggagacatgtctcaacatgaaactttgcattgccatcagttagcagtggcatactgctta
cgagcattatgtacccaggaagctgaaccaaactctaagcaagttattgaagatattggg
gctgccctaaatctgtggttgagcgtatcaatttgctttgagagcgaacgttgcaatatg
gtctctgaaaatacaatgctactactctataatgtagtcgatttattatcattaaagggt
ttcatcgaatttcacaataacatatataaactgatgcttagattatttaagtgcaagaat
gttccattggaaaagtatttgtccattctgtgggaaagtagaaggctcagtcatgctctt
tgcatttcacctgtaaatgacgcattcctcgtgaacttagcggagcaatgtggcgaactt
tccaagtctattgaattctggatgggctgtttacagggatcccaaccattactggttgga
ttccaacagagtctcttatttttatttgctaattcttctcatggctgttacattcgcaaa
agttctgttcagccatgcatcacaatcaatgatgttaaagaggctgcttctgagctgatc
tcaagtgttcctgtaacccctcgttctgttttccttgttggatatctttactatgactta
tgcgaaagactcattgcaaatggacgactgttggaggctctttcatacgctatagaggcc
catcgactacgtactcaactctttcaagagaaattttcatactctgttgagaacagtgtc
aaagagtacaatgatgctggggacatcagtcagaaactacattccagtcctaaaggtttc
aaaccatctagttcagttgcaagtgaagtttggtctttcgatgcttcttcatggaacgta
gatggctgctatctcagtccatggaatgtgctacagtgttatcttgaaagtgtcctccag
gttggaatcatccatgaattagttggaaatggagttgaggctgaagcctttttactgtgg
ggaaaaagcatctcttgcactcaaagtttgccacaatttatagttgccttttcttctatt
ttaggaaaattgtaccgtaagaaacagctttgggatcaggcagaaaaggagcttaagaat
gctaaacaaattttggtagagaaaagtataaatttatcatgcttgaagtgtagattgatt
ctggaagtgactgttgatcagcaacttggtgatctatcacgaagttattctggttgtgat
gatagagggaatactttgatcgaaaggctgtctaatgctgaaaaactctacaaatctgcc
ttagacaaattaaatctttctgagtggaaaaactcgattagtcttcctgaagaagctagg
tcggagagcatactgcctaaaaaaccttctatacaaaatgttgaacatggtgctggcaat
acttctgtccattctaccttgcatcagccagatacagtggaacttacagcaaggaaccag
ttgagtgcaaaggtggggggaactaagtgtagaaagactaagaatgcactaaaatcgttg
gtaaatgatcaaaatttggaccttgatcccaattccaggataactcgttccaagtgtcgg
tcttctcaaaaccaatctgttaacaattgcgttgaggaacgatcaggtgtttcaaaacat
gctaaaaataacaatttatctgatcttcctgacattcttagtcaagggaagtcagtcttg
gaggcaaaaagttttgttgatactgggtatcaagctgcttgcatctgcaacaaaatgaag
tgctggcaatgccttcctggggaagttattgaatctgggttgctagacaatttattacgc
gtgaaatgggagttcactcgcaggcgtctatcgctgagagtactcgctggtataggaaaa
tgctttggaaatcgtgatcagactcatgaggcacacaaaattgtttttcaaagtgtatct
gtcctcctgtgcagaaactcattttctcatactgactcttctcttccagtgactgtcttg
cttgatttaattggtaaggagtactcagaagatgtttttgctgttgaacgtgcgggagta
ctttacaacctttgttggttctctttgaagggttactgttctatgaaatccaggaacagt
tgctgtgatctgtctcacttacagttgcagaaattagtttcttggttgatgctggccttt
gtgctttgccgtgaggctcccattctttttcagaaggtttctaaactgctcgcagttatt
tatgtactctcttccacaagcaagctcttttctctgtcatcttcctccaaagtactctct
gaaagtcattgggcttctttttttcatcaagcttcacttggaactcatcttaattacaag
ttcttatcaaatatgagttggcgatttaaagcacaagacattgtggatactgaggcctca
catgtaactggctcatcttgcatcaagacagaaacgggcaaattaatcaggatttctcct
gaatccatcaaagatcttgaacaatttgtaaaagattttcttttgagccttccttgcacc
accgtaatctgtgtgactttgctaggaggtgcttatactaggttattacaagagttgcta
ccgctcccttcatgtgttcatgcatggatgatgttgtcacgcttcaattctataaatcag
cctattgttgtccttctaccagtaaatgcagtactacaagaggatgcagactatgacgat
gatgatgcaattactagctttagggaattgcgtgagattaaggattgtggtaaaaactgg
cactgcccctggggttccaccatagcggatgatgtagctccagcatttaaactaataatg
gaggacaactatttatcgtcaagaagttcctacggagattcactggggcaaagatcattg
tggtggaaccggaggacaaagcttgatcagcgtctttgtgaatttttaaggaaattagag
gattcatggttgggtccttggaaatacatgcttctaggagaatggtcaaactgcaagaac
ctggacacagtacataaaaaactggtccgtgatctgaaatgtaaatgcaaagctaacata
aacgaaagccttcttagaattgttcttggaggtttgaagggtgcttttaaaggcgaggaa
tgtatagcacaactgtgcttcaagaaaggttgctacgtgggtacagttggatattctgat
aacagtagttgtgggacctcatctgaggcatcaaatggagttgaaagactttctgagttg
gcccttcaattaatacacaaagcagtggatgaactagaagatgactctggacatagagaa
cctactattctagtgctggattgtgaagtgcagatgctaccatgggagaatttacctata
ctgagaaaccatgaggtctatcgcatgccttctgttggtagcatagctgcaactctggag
agaatccaccaccatgaacagcttgttaaggggcttcttgctacttttcctttgatagat
cccatggatgcattttatttgttaaatcccagtggcgacctcagcgaaacacaacttctg
tttgaggactggtttagagatcaaaatttggtggggaaggctggatctgcacccacagct
gaagaactgactctagccttgaaaagccatgacctcttcatatatcttggccatggaagt
ggttcacaatacgtttctaggcatgatcttctgaagctggagaagtgtgctgctactttc
ttgatgggatgcagtagtggttctttgtcattaaacggttgttacattccgcaaggtact
cctctgtcctatctgctagccgggtcccctgtaattgttgccaacctttgggacgttaca
gacaaggacatagaccgttttgggaagaccatgcttgatgcttggttaagggaaaggtca
agtgttcccatgggctgtgaccaatgctcttcagttcaagatgaggccaagaacggaaga
ggcaaagttaacaaaaaaagaatgttgcggaagaaattacctgaaacttcggatattagt
ttatgtaacaatggttgtgatcatagaccaaagcttggatcattcatgggccaagctcgt
gaagcatgtaaactccctttcttgattggggctgcaccggtgtgttacggtgtcccaacc
ggtataagaagaaaaccaagtttatag

DBGET integrated database retrieval system