KEGG   Citrus clementina (mandarin orange): CICLE_v10000109mgHelp
Entry
CICLE_v10000109mg CDS       T02982                                 

Definition
(RefSeq) hypothetical protein
  KO
K08247  methionine S-methyltransferase [EC:2.1.1.12]
Organism
cic  Citrus clementina (mandarin orange)
Pathway
cic00450  Selenocompound metabolism
cic01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cic00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CICLE_v10000109mg
Enzymes [BR:cic01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.12  methionine S-methyltransferase
     CICLE_v10000109mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Methyltransf_31 MTS PrmA Methyltransf_25 Methyltransf_12 Methyltransf_11 Methyltransf_23 Met_10 Methyltransf_32 Methyltransf_4 ChpXY
Motif
Other DBs
NCBI-GeneID: 18040193
NCBI-ProteinID: XP_006431408
UniProt: V4SAW0
Position
Unknown
AA seq 1083 aa AA seqDB search
MTAATATAEAEAVEEFLRKCEASGDEAYGAFRSVLEKLEDPSSRTQARVFLSDLQKRVND
SDECLNKYHFRIQDVVLDQYEGYQGRKKLTMMVIPSIFIPEDWSFTFYEGLNRHPDSILK
DKTVAELGCGNGWITIAIAEKWLPSKVYGLDINPRAIRISWINLYLNALDEKGQPIYDAE
KKTLLDRVEFHESDLLAYCRDHDIQLERIVGCIPQILNPNPDAMSKIITENASEEFLYSL
SNYCALQGFVEDQFGLGLIARAVEEGIGVIKPSGIMIFNMGGRPGQGVCKRLFERRGFRV
DKLWQTKILQASDTDISALVEIEKNSPHRFEFFMGLSGDLPICARTAWAYGKAGGRISHA
LSVYSCQLHQPNQVKKIFKFLKNGFHEISSSLDLSFEDDSVADEKIPFLAYLASVLKERS
FFPYEPPAGSKRFRNLIADFMKKYHHIPLNADNVVVFPSRAVAIENALRLFSPRLAIVDE
RLTRHLPKHWLTSLTIKGTDTENSSEHELTVIEAPRQSDLMVELIKKLKPQVVISGIGDF
EAVTSSAFVHLLDVTREVGSRLFLDISDHFELSSLPSSNGVLKYLAGNVLPSHAAVICGL
VKNQVYSDLEVAFLISEEEAIFKALSKTVEVLEGTTALISQNYYGCLFHELLAFQLAERH
THKERDCEKAKSTEMIGFSRSAISVLNSAELSITETPNSGLIHMDVDQSFLPIPSLVKAA
IFESFARQNMSESEIDVTPSIQQYIKSNFGFPIDINAEFIYADCSQSLFNKLVLCCILEG
GTLCFPAGSNGNYVSAARFLKANIVNIPTESEVGFKMTEKTLVTILETVKKPWVYISGPT
INPTGLLYSNKEIENILTVCAKYGARVVIDTAFSGLEFNYEGWGGWDLEGCLSKLYSSTN
SSFNVSLLGGLSLKMLTGALKFGFLVLNHPQLVDAFSSFPGLSKPHSTVRYAIKKLLGLR
ERKARDLMNAVAEHIRNLESRSKRLKEALENCGWEAVQSCGGVSMVAKPSAYLNKTVKIS
RHSSGSGEKTATEQIKLDDSNIREAIVKATGLCINSGSWTGIPGYCRFTIALEESELNEL
WIA
NT seq 3252 nt NT seq  +upstreamnt  +downstreamnt
atgacggcagcgacggcgacggcggaggcggaggcggtggaggagttcttgaggaaatgc
gaggcgtcgggtgacgaggcgtacggtgcgtttcggtcggtgttggagaagctggaggat
ccgagtagtcggactcaggctcgggtcttcctttcggatcttcagaaacgggtcaatgac
tcggacgagtgtctaaacaagtaccatttccggatccaagatgtcgtcttggaccaatac
gaaggctaccaagggagaaaaaaattgacaatgatggtcatccccagcatttttatcccg
gaagactggtcatttactttctatgaaggactgaatagacatcctgactctattttgaag
gacaagactgttgctgagcttggttgtggaaatggatggataaccattgccatagctgag
aagtggttgccttcgaaggtctatggccttgatattaatcccagagcaataaggatctct
tggataaatttgtacttaaatgcattagatgaaaaaggtcagcccatctatgatgcggag
aagaaaactttactggacagggtggagtttcatgaatctgatcttctcgcttattgcaga
gatcatgacattcaacttgaacgaatagtgggatgcatacctcagattcttaaccccaat
cccgatgcaatgtccaaaataatcactgaaaatgcaagcgaggaatttctgtattcattg
agtaactattgtgcgctgcagggttttgtggaggatcagtttggcttaggtctaattgct
agagcagttgaggaaggaattggtgtcatcaaaccttccgggattatgatcttcaatatg
ggtggtcgtccaggacagggcgtttgtaagcgtttgtttgaacgccgtggtttccgtgtc
gacaagctttggcagactaaaattcttcaggcttctgacacagatatttcagctttagtt
gaaattgagaagaacagtcctcatcgttttgagttcttcatgggactttctggtgactta
cctatttgtgctcgaacagcatgggcctacggaaaggctggtggacgtatctctcatgct
ttatcagtttatagttgtcaactccatcaaccaaaccaggttaagaaaatttttaagttt
ctgaaaaatggcttccatgagatcagcagttctttggatttatcttttgaagatgattca
gttgctgatgagaagattccattcctggcttatcttgccagtgttctgaaagagcgttct
tttttcccctatgagccaccagctggaagcaaaagattcaggaacctgattgctgacttc
atgaaaaagtaccaccatattccgctaaatgctgataacgttgttgtctttccttcaaga
gctgtggcaattgagaatgctcttcgattattttcacctcgccttgcaattgttgatgaa
cgtctaaccagacacttaccaaagcactggttaacaagtttaacaattaagggtacagat
actgaaaactcttcggagcatgaactaacagtaattgaagcgccacgccagtcagatttg
atggtggagctgataaagaagctgaagcctcaggtggtaatttctgggattggtgatttt
gaggctgttaccagttcagcctttgtacatcttctagatgttacaagagaagttggatct
cgtcttttcttggatatatctgatcactttgagctctccagcctcccaagttccaatggg
gtccttaaatatcttgctggaaatgttcttccttcacatgcggcagttatttgtggcctt
gttaaaaatcaggtttattcagatttagaagttgcttttctaatctcagaagaagaggcc
atctttaaggccttgtcgaagactgtggaagtactagaagggactactgcactgattagt
caaaactactatggttgtctttttcatgagcttctggctttccagcttgctgagcgacat
acacataaagagagggattgcgaaaaggccaaatcaactgagatgatcgggttttctaga
tcagccatctctgtcctcaacagtgctgaactgtcaattaccgagacaccaaactctggc
ctgattcatatggatgtagaccaaagcttcttgcctataccgtctctggtcaaagctgct
atctttgaaagtttcgcaagacaaaacatgtctgagtcagaaattgatgtcacccccagc
atccaacagtatatcaagagcaattttggttttccaattgatatcaatgcagaattcata
tatgcagattgctctcaatctctgtttaataagctagtcctctgttgtatcctagaaggt
ggaacattatgcttcccagctggctcaaatgggaactatgtttctgctgccagatttttg
aaagcgaacattgtgaatattcctactgagtctgaagtgggctttaagatgacagagaag
acacttgtgacgatactcgagaccgtgaagaagccgtgggtgtacatttctggtccaaca
atcaatccaactggcttgctttacagcaacaaagagatagagaatatattaactgtttgt
gcaaagtatggggcaagagttgtgattgatactgcattctcaggattggaattcaactac
gagggttggggtggctgggatttggaaggctgtttgtcaaagctgtattcttccaccaat
tcatctttcaatgtgtcgctgctcggagggctgtctctgaagatgctgactggagcactc
aaatttgggtttctggttctaaatcatcctcagttggttgatgcatttagtagcttcccg
ggattaagcaagcctcatagcacggtcagatacgctataaagaagttgcttggtctgaga
gagcgaaaagcaagagacttgatgaatgctgttgcagaacatataagaaacttggaaagt
agatcaaagcgcttgaaagaggcacttgagaattgtgggtgggaagcggttcaatcctgt
ggtggtgtttcaatggtggcgaagccctctgcctatctcaacaaaactgtaaagatcagc
cggcattcatctggcagtggtgagaaaactgctacagaacaaatcaagcttgatgactca
aatatcagggaagccatagtcaaggcaactggtttgtgcatcaacagtggctcgtggacc
ggaattcctggctattgtcgcttcacaattgcactggaagaaagcgaattgaacgagctt
tggattgcatag

DBGET integrated database retrieval system