KEGG   Citrus clementina (mandarin orange): CICLE_v10000710mgHelp
Entry
CICLE_v10000710mg CDS       T02982                                 

Definition
(RefSeq) hypothetical protein
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
cic  Citrus clementina (mandarin orange)
Pathway
cic00564  Glycerophospholipid metabolism
cic01100  Metabolic pathways
cic01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cic00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CICLE_v10000710mg
Enzymes [BR:cic01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     CICLE_v10000710mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PS_Dcarbxylase EF-hand_1 EF-hand_5 EF-hand_6 EF-hand_7 EF-hand_8 C2
Motif
Other DBs
NCBI-GeneID: 18043157
NCBI-ProteinID: XP_006432454
UniProt: V4V1P8
Position
Unknown
AA seq 534 aa AA seqDB search
MGHGSSKEDESVSRTSRFRKKFHLHRERRRSRGNGSNSGSHHHNRVLNEEDFAGIALLTL
ISAEMKFKDKWLACVSLGEQTCRTAISDNTDKPIWNSEKKLLLERNGPHVARISVFETNR
LSKSNLEGYCEVDLLEFLTKDSDTDFEVFDLLDPSSSNKIVGKISLSCSVEDPIETEKSF
ARRILSIVDYNQDGQLSFKEFSDLISAFGNQVAANKKEELFKAADKNGDGVVSVDELAAL
LALQQEKEPLMNCCPVCGETLEVADMVNTMIHLTLCFDEGTGNQVMTGGFLTDKQASNVW
MFKLSEWGHFSSYDVGLNSGSRAHILVFDRRTKRLVEELIDVKIVMSMRAIYQSKIGLGL
MDIGTKELLKSISEKQGRKMNSVESSKEIPKFVNFFKDQINLADVKYPLEHFKTFNEFFI
RELKPGARPIDCMEREEVAVCAADSRLMAFKSVEDSLRFWIKGQKFSIQGLLGNDICSNS
FLNGTMVIFRLAPQDYHRFHLPVSGIIEQFVDIPGCLYTVREEIQFTGIMIACL
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggggcacggaagctcaaaagaagatgagagtgtctcgcgcacgtctcgattcaggaag
aagtttcacctccatcgtgaacgacgccgttctcgtgggaatggctcaaactctggatct
catcatcacaatagagttctcaatgaagaggatttcgctggaattgctctcctcactctg
attagcgcggagatgaagttcaaggacaagtggcttgcatgtgtttcacttggagagcag
acgtgtcgcactgcgatttctgataatacggataaacctatctggaattctgaaaagaaa
cttctcttggaaaggaatgggcctcatgttgctaggatatcggtatttgagactaataga
ttgtcgaaaagcaatcttgaaggatattgtgaagttgatctccttgaatttctaacaaag
gattcagacactgactttgaggtatttgaccttttagatccatcatcatctaacaaaatt
gttggcaagatttctctatcatgttctgttgaggatccaattgaaacagagaaaagtttt
gcaagacgcatattatcaattgtggattacaatcaggatggacagctttcgttcaaagag
ttttctgacttaattagtgcttttggcaatcaagtggctgctaataagaaagaggaactt
ttcaaagccgccgacaaaaatggagatggggttgtgagcgttgatgagttagctgccctt
cttgctcttcaacaagaaaaggaacccctcatgaattgctgtcctgtttgtggtgagact
cttgaagttgctgacatggtgaatactatgattcatttgactctgtgttttgacgaggga
actggaaaccaggttatgactggaggattcttgactgataaacaagcttcaaatgtctgg
atgtttaaactaagtgaatggggccatttttcatcttatgatgttggcttaaactctggt
tcaagagctcatattctggtttttgatcggaggacaaaaaggctggtggaagaattgatt
gatgttaagattgttatgtcaatgagagcaatttaccaatcaaaaatagggcttggcctc
atggacatagggacaaaggaactgttgaagagcatctctgaaaagcaaggaaggaaaatg
aattcagttgaatcatctaaagaaatcccaaagtttgtaaacttctttaaggatcaaatc
aacttggctgatgtcaagtaccctttggaacattttaagacatttaatgaattcttcatt
agagagttaaaaccgggtgcaagaccaattgattgcatggaacgtgaagaggttgctgta
tgtgcagctgatagtcgtctgatggcttttaaatcggttgaagacagccttagattttgg
atcaagggtcaaaagttttcaattcaaggtcttttgggaaatgacatatgttccaattct
tttttaaatggaactatggtgatttttcggttggcgccacaggattatcatcgttttcat
cttccggtgtcgggaatcattgagcaatttgtggatatacctggatgcctatacactgta
cgtgaggaaattcaatttacagggatcatgatagcttgtctataa

DBGET integrated database retrieval system