KEGG   Citrus clementina (mandarin orange): CICLE_v10000723mgHelp
Entry
CICLE_v10000723mg CDS       T02982                                 

Definition
(RefSeq) hypothetical protein
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
cic  Citrus clementina (mandarin orange)
Pathway
cic00350  Tyrosine metabolism
cic00360  Phenylalanine metabolism
cic00380  Tryptophan metabolism
cic00950  Isoquinoline alkaloid biosynthesis
cic00965  Betalain biosynthesis
cic01100  Metabolic pathways
cic01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cic00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    CICLE_v10000723mg
   00360 Phenylalanine metabolism
    CICLE_v10000723mg
   00380 Tryptophan metabolism
    CICLE_v10000723mg
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    CICLE_v10000723mg
   00950 Isoquinoline alkaloid biosynthesis
    CICLE_v10000723mg
   00965 Betalain biosynthesis
    CICLE_v10000723mg
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cic04147]
    CICLE_v10000723mg
Enzymes [BR:cic01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     CICLE_v10000723mg
    4.1.1.105  L-tryptophan decarboxylase
     CICLE_v10000723mg
Exosome [BR:cic04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CICLE_v10000723mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC DUF1148
Motif
Other DBs
NCBI-GeneID: 18040184
NCBI-ProteinID: XP_006434677
UniProt: V4T407
Position
Unknown
AA seq 567 aa AA seqDB search
MEKLSSTIYTPSRGTEVITNKPPTLPIPTFLASIFFPFNFNLFSAQMGSLTSDQLDGNSG
LVINPLDPEEFRRQAHMVIDFIADYYKNVDKYPVRSQVEPGYLRKRLPECAPYNPESMET
ILQDVQEHIVPGVTHWQSPNYFAYFPSSGSIAGFLGEMLSSGFNVVGFNWISSPAATELE
NIVMDWLGQMLKLPKSFLFSGNGGGVIQGTTCEAILCTLTAARDRVLNKIGRENISKLVV
YGSDQTHCALQKAAQIVGIDLKNFRAIKTTKSSSYGLSPDSLLTQINLDVEAGLVPLFLC
ATIGTTAITAVDPLKPLCDVAKQFGIWVHVDAAYAGSACICPEFRHFIDGVEGADSFSLN
AHKWFFTTLDCCCLWVKDPSALVSSLSTNPEYLKNKATESKQVVDYKDWQITLSRRFRSL
KLWLVIRNYGVANLRHFLRSHVNMAKLFERLVASDKRFEIVFPRQFSVVCFRVSPSAVMD
KLKPKYENCHSQQLFTEEEAINEFNRELLESINASGKAYMTHAVCGGIYAMRFAVGATLT
EERHVMVAWTMVQEQLEAFLTTNTPFN
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atggagaagctatcttccaccatttatacaccaagccgaggaacggaggtaataacaaat
aagccaccaactcttcctattccaacattcttagcctccattttctttccattcaatttt
aatttgttttcagctcaaatgggcagcctcacatctgaccaactcgatggcaattcaggt
ttagtcattaaccctctggacccagaggaattcaggaggcaagcccacatggtaattgac
ttcattgctgattactacaaaaatgtcgacaaatacccggttcgaagccaagttgaacct
ggctatctcagaaaacgcttgccagaatgcgccccgtacaatcctgagtccatggaaaca
atcctccaggatgtacaagaacacattgtccctggtgtaacgcactggcaaagccccaac
tacttcgcttactttccttcaagtggtagcatcgccggatttctcggtgaaatgctgagc
tctggctttaatgttgtgggattcaattggatctcatcgccggctgcaactgagcttgag
aatatagtaatggattggcttggtcaaatgctcaagcttcccaagtctttccttttctca
ggcaatggcggtggagttatacagggaactacatgtgaggccattctgtgcacactaact
gctgcaagagatcgggttctgaataaaattggaagagaaaatatatccaagctagttgtg
tatggatctgatcaaactcattgtgccctccagaaagctgcccagattgtcggaatcgat
ctcaagaatttccgagctattaagacaacaaaatcgtcatcctatgggctatctccagac
tcactgctgacacaaatcaacttggatgtagaagctggattggtcccattattcctatgt
gccacaatcgggacgactgcaatcactgcagttgatccattgaagccgctttgcgacgta
gcaaaacaatttggaatatgggtccatgtggatgcagcatacgcaggaagtgcctgtatt
tgcccagagtttcgacattttatcgatggagttgaaggtgcggactcgtttagtctcaat
gcacacaaatggttctttacaacattagattgttgttgcctctgggtgaaggatccaagc
gcactcgtgagctctctctcaacaaatcctgagtacttgaagaacaaagccacggagtcc
aaacaagtggtggactataaagattggcaaataactctaagtcgaagatttcgttcattg
aaattatggcttgtgataagaaactatggggtggcaaatctaaggcacttcctgcgcagc
catgtaaatatggccaagctttttgagaggcttgtggccagtgataagaggtttgaaatt
gtgtttcccaggcaattttccgttgtgtgtttcagggtttctccatcggcagtcatggat
aaacttaaacccaaatacgaaaactgtcattctcaacagctcttcacagaggaggaagca
ataaatgagttcaatcgagaattattggagtccataaatgcatctgggaaagcctacatg
acccacgccgtttgtggaggaatatatgccatgcgattcgccgttggtgctacgttgacg
gaggaacgacacgtgatggttgcttggaccatggtgcaagagcaattggaggcatttcta
accacaaatacacccttcaattag

DBGET integrated database retrieval system