KEGG   Citrus clementina (mandarin orange): CICLE_v10002463mgHelp
Entry
CICLE_v10002463mg CDS       T02982                                 

Definition
(RefSeq) hypothetical protein
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
cic  Citrus clementina (mandarin orange)
Pathway
cic00350  Tyrosine metabolism
cic01100  Metabolic pathways
Module
cic_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:cic00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    CICLE_v10002463mg
Enzymes [BR:cic01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     CICLE_v10002463mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3
Motif
Other DBs
NCBI-GeneID: 18040949
NCBI-ProteinID: XP_006431355
UniProt: V4SZS5
Position
Unknown
AA seq 194 aa AA seqDB search
MLKLFSYWRSSCSHRVRIGLNLKGLEYEYKAVNLVKGEQFSPEFLKINPIGYVPALVDGD
FVVSDSFAILMYLEEKYPQPPLLPSDLKRKAINYQAANIVSSSIQPLQNLAVVKYIEEKA
GADERDIWAKTHIGKGFAALEKLLKDYAGKYATGDEVFLVSFHCFIYVRSKPFYNTQSSF
QKQGVETPIGGIEV
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaactgttttcatactggaggagttcatgctcacatcgtgtcagaattggtctc
aacttgaaagggttagaatatgagtacaaagcagttaacttggtgaaaggagagcaattc
agtcctgagtttttgaagatcaaccctattggctacgtgccggctttggttgatggagat
tttgttgtatctgattcttttgccattttaatgtacctggaagagaagtatcctcagcct
ccattgttgccttctgatcttaagagaaaagctatcaattatcaggctgcaaatattgtt
tcctcgagcatacagcctcttcagaatcttgctgtagtgaagtacattgaggaaaaagct
ggtgcagatgagagagacatctgggctaaaactcacattggaaaaggctttgcggcactt
gagaagctgctaaaagactatgctgggaaatatgcaactggagatgaagttttcctggtt
agttttcattgcttcatctatgttcgtagtaaacccttctacaacacacaaagctcattc
caaaagcagggagtagaaacccctattggtggaattgaggtttaa

DBGET integrated database retrieval system