KEGG   Citrus clementina (mandarin orange): CICLE_v10005833mgHelp
Entry
CICLE_v10005833mg CDS       T02982                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cic  Citrus clementina (mandarin orange)
Pathway
cic00480  Glutathione metabolism
cic01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cic00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CICLE_v10005833mg
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cic02000]
    CICLE_v10005833mg
Enzymes [BR:cic01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CICLE_v10005833mg
Transporters [BR:cic02000]
 Other transporters
  Pores ion channels [TC:1]
   CICLE_v10005833mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3 GST_N_4 GST_C_6
Motif
Other DBs
NCBI-GeneID: 18032130
NCBI-ProteinID: XP_006420435
UniProt: V4S4G4
Position
Unknown
AA seq 222 aa AA seqDB search
MAEVKLHGGLLSPFNYRVVCALKLKGIPFELIKEDLSNKSALLLKYNPVHKKIPVLVHGG
KPVCESMVILEYIEETWPQNPLMPSDPYDRAQARFWINFAENKGAAVWKLFRSIEDQENT
MKEILEMLQIVEEHGLGEKKFFHGDKIGLVDIAFGSIVHWLQIIEDIVGVKLFESHKFPG
LHAWLKNYKQVPVVEENLPSRDELLVFFKGRYEKLQASARMQ
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagtgaagcttcatgggggattgctgagtccatttaattacagggtggtatgc
gctctgaaattgaaaggcataccttttgaattgattaaagaagatctctcaaacaaaagt
gcattgcttttgaagtataatccagttcacaagaagatcccagtgctcgttcatggcggc
aagccagtttgcgagtccatggttattctcgaatacattgaagagacgtggccacagaat
ccattgatgccaagtgatccttatgatagagctcaagctcgtttttggattaactttgcc
gaaaacaagggagctgctgtttggaaattgtttcgtagcattgaagatcaagagaatacg
atgaaagaaatcttggaaatgctgcaaattgttgaagaacatggcttaggagaaaagaaa
tttttccacggagacaagattggcttagttgacatagcatttggttctattgttcattgg
ttgcaaatcattgaagatatagtgggagtgaaactctttgaatctcacaaattcccaggc
ttgcacgcgtggttaaaaaattacaagcaagtccctgtagttgaagaaaacctccctagt
agggatgaactgttggtctttttcaaaggtcgctatgaaaagttgcaggcttctgccaga
atgcagtag

DBGET integrated database retrieval system