KEGG   Citrus clementina (mandarin orange): CICLE_v10005921mgHelp
Entry
CICLE_v10005921mg CDS       T02982                                 

Definition
(RefSeq) hypothetical protein
  KO
K02890  large subunit ribosomal protein L22
Organism
cic  Citrus clementina (mandarin orange)
Pathway
cic03010  Ribosome
Brite
KEGG Orthology (KO) [BR:cic00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CICLE_v10005921mg
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cic03011]
    CICLE_v10005921mg
Ribosome [BR:cic03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    CICLE_v10005921mg
  Bacteria
    CICLE_v10005921mg
  Archaea
    CICLE_v10005921mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-GeneID: 18032256
NCBI-ProteinID: XP_006419765
UniProt: V4S2N4
Position
Unknown
AA seq 201 aa AA seqDB search
MMISSTTRILLPSPPPTCLATRQLGHNPLILRWDQAGFTSRTDFSRKLSHTHNEIFNSKK
IISSAQKRGISPPNNRNKTNKKAEVSASARYLHMSAHKVRRVIDQIRGRSYEETLMILEL
MPYRACYPIFKLIYSAAANGVHNMGFNEASLVIVKAEVNEASSAKRPRPKAQGRVHMIKR
PTCHITVVLRDMSLDDEYAVS
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgatgatatccagcacgactcgtatcctcctcccctctccgccgccaacatgtttggcc
accaggcaactgggtcacaacccattaattctccggtgggatcaggctggttttacttca
agaacagatttttctcgcaaactttctcacacccacaatgaaatttttaattccaagaaa
ataatcagcagtgcccaaaagagaggaatatcgccgccgaacaacagaaacaagaccaac
aagaaggcagaagtgtctgcttcagctcgatatctgcacatgtctgctcacaaagtccga
agggtaattgatcagattcgcggacgttcttacgaggagacgcttatgatactggagctc
atgccttatcgggcctgttatcccattttcaaactgatttattctgcggcggcaaatggt
gttcacaatatgggcttcaacgaggccagtttagtcatcgtcaaagcggaagtgaacgag
gcttcttctgctaaaagaccgagacctaaagctcaagggagggttcatatgatcaaaaga
cccacttgtcatatcactgttgtgttaagagacatgtctttagatgatgaatatgcggtt
tcctaa

DBGET integrated database retrieval system