KEGG   Citrus clementina (mandarin orange): CICLE_v10007707mgHelp
Entry
CICLE_v10007707mg CDS       T02982                                 

Definition
(RefSeq) hypothetical protein
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
cic  Citrus clementina (mandarin orange)
Pathway
cic00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:cic00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CICLE_v10007707mg
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cic01007]
    CICLE_v10007707mg
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cic03016]
    CICLE_v10007707mg
   03029 Mitochondrial biogenesis [BR:cic03029]
    CICLE_v10007707mg
Enzymes [BR:cic01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     CICLE_v10007707mg
Amino acid related enzymes [BR:cic01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   CICLE_v10007707mg
Transfer RNA biogenesis [BR:cic03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CICLE_v10007707mg
 Prokaryotic type
   Other AARSs
    CICLE_v10007707mg
Mitochondrial biogenesis [BR:cic03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CICLE_v10007707mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1d Arg_tRNA_synt_N DALR_1
Motif
Other DBs
NCBI-GeneID: 18056164
NCBI-ProteinID: XP_006451324
UniProt: V4WDI2
Position
Unknown
AA seq 519 aa AA seqDB search
MANEEENTGNVKRELEKVFDLALKATVRNETDVRPLIAACTAKFGDYQCNNAMGLWSKIK
GKGTEFKGPQPVGQAIMKNLPPSEMIESCSVAGPGFVNVVLSKNWMAKNIQKMLVDGIET
WAPKLRVKKAVVDFSSPNIAKEMHVGHLRSTIIGDSLARMLEFSNVEVLRRNHVGDWGTQ
FGMLIEYLFEKFPNSEDANETAIGELQEFYRRSKNRFDSDPAFKERAQQAVVRLQSGEPK
YHEAWAQICEISRKEFDKVYKRLRVDLEEKGESFYNPYIPGVIDELSKQGLVEESQGARV
IFIEGVNIPLIIVKSDGGFNYASTDLAALWYRLNEEKAEWIIYVTDVGQQLHFDMVFSAA
KRAGWLSADDSTYPKASHVGFGLVLGEDGKRLRTRFSEVVRLVDLLDEAKNRSKAVLIER
GKDKEWTEEELEQTAEAVGYGAAKYFDLKNNRLTNYTFSFDQMLNDKGNTAVYLLYAHAR
ICSIIRKSGKDIEELKKVGLVFEVEALTMFQRSSFSINS
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatgaggaagaaaatacagggaatgtaaagcgagaattagagaaagtttttgat
ttagcacttaaagcaacagttcgtaatgaaacggatgtgaggccgctgattgctgcatgc
actgctaaatttggcgattaccaatgtaataatgctatgggtctgtggtctaaaattaaa
ggaaagggtactgaatttaagggtccccaacctgttggacaggccatcatgaaaaatctt
cctccgtctgaaatgatagaatcatgctctgtagctggacctggatttgtgaatgtagtg
ttatcaaagaactggatggctaagaacattcagaagatgcttgttgatggtatcgaaaca
tgggcaccgaaacttagggttaaaaaagccgtggtcgacttttcctcacctaatatagca
aaagaaatgcatgttggccacttgcgatcaactattattggggactcactggcccgaatg
cttgagttttcaaatgttgaagttctccgacggaatcatgttggtgactggggtacacag
tttggcatgttgattgaatacctttttgaaaaatttccaaactcggaagacgcgaatgaa
acagccattggagaattacaagaattctacaggcgatcaaaaaatagatttgattctgat
cctgcttttaaggagagagcacaacaggcagtggttcggcttcagagtggggaaccaaag
tatcacgaggcttgggcgcaaatctgtgagatcagccggaaagagtttgataaggtctac
aaacgccttcgagttgacttggaggaaaagggggaaagtttttataatccgtacattcct
ggggttattgatgaattgagtaagcaaggtttagttgaagagagccagggtgctcgtgtg
atttttattgaaggagttaacatacctctcatcattgtgaagagtgatggtggtttcaac
tatgcttcaacagatcttgctgctctttggtaccgccttaatgaagagaaagctgagtgg
attatctatgtcactgatgttggtcagcagctacattttgatatggtgttcagtgctgcc
aaacgtgctggttggctttcagctgatgatagtacgtacccgaaggccagtcatgttggt
tttggacttgttctcggagaagatggcaagcgacttcggactcgcttttctgaagtggtt
cggttggttgatttacttgatgaagccaagaatcgcagtaaagcggtgcttattgagcgt
ggtaaggataaagagtggactgaagaggagcttgagcaaaccgctgaggcagtgggttat
ggtgctgctaagtattttgaccttaagaacaacagattgaccaattacacgtttagtttt
gatcagatgcttaatgataagggcaatactgctgtttatttgctttatgctcatgcgagg
atctgttccatcatcaggaaatctggtaaagacatagaagaactgaagaaggtaggtttg
gtttttgaggtagaagctctgacgatgtttcagcggtcgagtttctccataaattcctga

DBGET integrated database retrieval system