KEGG   Citrus clementina (mandarin orange): CICLE_v10007996mgHelp
Entry
CICLE_v10007996mg CDS       T02982                                 

Definition
(RefSeq) hypothetical protein
  KO
K05350  beta-glucosidase [EC:3.2.1.21]
Organism
cic  Citrus clementina (mandarin orange)
Pathway
cic00460  Cyanoamino acid metabolism
cic00500  Starch and sucrose metabolism
cic00940  Phenylpropanoid biosynthesis
cic01100  Metabolic pathways
cic01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CICLE_v10007996mg
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    CICLE_v10007996mg
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    CICLE_v10007996mg
Enzymes [BR:cic01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     CICLE_v10007996mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-GeneID: 18054218
NCBI-ProteinID: XP_006451937
UniProt: V4UGI1
Position
Unknown
AA seq 523 aa AA seqDB search
MISKFHHFSAFLFFLVLLQLWPVLSLAKSTCNENEQVDVKRSDFPDGFLFGTATSSFQVE
GAYLEDGKSLSNWDVFSHIPGNIENNDNGDVADDHYHRFLEDIEIMHSLGVNSYRFSISW
PRILPKGRFGEVNPAGINFYNYLIDNLLLRGIEPFVTIYHHDFPQQIEDKYGSWLSPQMQ
KEFVHLAKTCFENFGDRVKYWATLNEPNLLTDMAYIRGTYPPTHCSAPFGNCSAGNSDTE
PLIVLHNMLLSHAKAVKLYRKHFQEKQGGSMGIVLHSMMYEPLRDEDSDRQAVSRALAFN
VGWMLDPLVFGDYPAEMREYLGSQLPRFSKEETKYVKGSLDFIGINHYSTLYAKDCIHSV
CVLGSNHAIRGFVYTTGERDGIMIGEPTGNPRFFVVPEGMEKIVDYVKDRYKNIPMYVTE
NGYSPPKQKNQRSQDLVDDVKRIEYHSGYLSALARAIRNGADVRGYFIWSLMDNFEWLDG
YSVMFGLYYIDRQTLERTPKLSATWFKNFLTDNTSHTIEKSSI
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgatctctaaatttcatcacttctctgctttcctcttcttccttgttctgcttcagctt
tggcctgttctttctttagctaaaagcacttgcaatgagaacgaacaagtagatgtcaaa
aggtctgatttcccagatgggttcctctttggcacagccacttcttcgtttcaggttgaa
ggagcctatcttgaggatggtaaaagcctcagcaattgggatgtttttagtcatatccct
gggaacatagaaaataatgataatggggatgttgctgatgatcattaccatcgcttcttg
gaagacattgagataatgcattctcttggagtaaattcatatcgattttcgatttcatgg
cctagaattttacctaagggaagatttggtgaagttaatccagctggaatcaatttttat
aattatcttatagacaatctcttactcagaggaattgaaccatttgtgacaatttatcat
catgactttccacaacaaattgaagacaaatatgggtcttggctcagtcctcaaatgcag
aaagagtttgttcatctagccaaaacatgttttgagaattttggtgatagagttaagtat
tgggcaactcttaatgagccaaatttattaaccgacatggcttatatcagaggcacgtac
cccccaactcattgttcagcaccatttggaaattgctctgctggcaactctgatacagaa
cctctcattgttctgcataacatgttgttgtcacatgccaaggctgttaagctatacaga
aagcactttcaggaaaaacaaggtggttcaatgggaatagttttgcattcaatgatgtac
gaaccgctgagggatgaagactcagatcgccaagctgtgagtagggcccttgctttcaat
gtgggctggatgttggatcccttagtatttggagactaccctgctgaaatgcgtgaatat
cttggatctcaattgccacggttttccaaagaggaaactaagtacgtcaaaggcagtctt
gatttcattggcatcaaccattattccactctgtatgccaaggactgcatccattctgtt
tgtgttttgggcagcaatcatgcaatccgaggctttgtttacaccactggagaacgggat
ggcatcatgatcggagaaccgactgggaatccaagattctttgttgtcccagaaggtatg
gagaaaattgtagattacgtcaaagacagatacaaaaacatccctatgtatgtgacagaa
aatggatattcaccaccaaagcagaaaaatcaacgatctcaagatttagttgatgatgtc
aagcgaatcgagtaccattcaggctacctttctgctctggccagagctataaggaatggg
gcagatgttcggggatattttatttggagcttgatggacaacttcgagtggctagatggc
tactccgtcatgtttggtctttactacattgatcgtcaaacgcttgagcgaactccaaaa
ctttctgctacgtggttcaaaaatttcctcacagacaacactagccataccatagaaaag
agttcaatctaa

DBGET integrated database retrieval system