KEGG   Citrus clementina (mandarin orange): CICLE_v10009052mgHelp
Entry
CICLE_v10009052mg CDS       T02982                                 

Definition
(RefSeq) hypothetical protein
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
cic  Citrus clementina (mandarin orange)
Brite
KEGG Orthology (KO) [BR:cic00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cic01001]
    CICLE_v10009052mg
   01009 Protein phosphatases and associated proteins [BR:cic01009]
    CICLE_v10009052mg
Enzymes [BR:cic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CICLE_v10009052mg
Protein kinases [BR:cic01001]
 Serine/threonine kinases: Other
  Wnk family
   CICLE_v10009052mg
Protein phosphatases and associated proteins [BR:cic01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CICLE_v10009052mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal APH Kdo DUF3225
Motif
Other DBs
NCBI-GeneID: 18055278
NCBI-ProteinID: XP_006452512
UniProt: V4UI19
Position
Unknown
AA seq 296 aa AA seqDB search
MMPAVNSDPSDKDSEPFIETDPTGRYGRYNELLGSGAVKKVYRAFDQEEGIEVAWNQVKL
RTFCDDPAMIERLFSEVRLLKTLANKNIISLHYVWRDEDRNTLNFITEVCTSGNLREYRK
KHRHVSVKALKKWSKQILKGLNYLHTHEPCVIHRDLNCSNVFVNGNTGQVKIGDLGVAAI
VGKSHSAHSMLGTPEFMAPELYDEDYTELVDIYSFGMCVLEMVTLEIPYSECDNVAKIYK
KVSSGQRPDALNKIKDPEVKEFIERCLAQPRARPSAAELLKDPFFDGIEDDDENDL
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgatgccggctgttaactcggatccatccgacaaagactccgagccgtttatagagacc
gaccccaccggccgatacggccgatacaacgaactacttggctccggcgccgtgaagaaa
gtgtaccgagcatttgatcaagaagagggcatagaagttgcatggaatcaagtgaagcta
agaaccttctgcgacgatccggcgatgatcgaaaggctcttctcggaagtccgtttgctg
aaaaccctagccaacaagaacataatctccttgcactacgtgtggcgcgacgaggatcgc
aacacattgaatttcatcaccgaagtctgcacttccggtaacttgagagagtaccggaaa
aagcaccggcatgtttccgtgaaggcgctcaagaaatggtcaaagcaaatcttgaagggg
ttgaattatttgcacacgcacgagccttgtgtcattcatagggatctcaattgtagcaac
gttttcgtcaacggaaacactggccaggttaagatcggtgatctcggggtggcggcgata
gtgggaaagagccattcggcgcattcgatgctggggacgccggagttcatggcgccggag
ctgtacgatgaggattacacggagcttgtggacatatactcgtttgggatgtgcgtgcta
gagatggtgacgttggagataccttacagcgaatgcgacaatgtggccaaaatttacaag
aaggtgtcgtctgggcagagacctgatgcattgaacaagattaaggatccagaggtaaag
gagttcattgagaggtgtcttgctcagcctagggcgcggccgtcggcggccgagctactt
aaggatcctttctttgacgggatcgaagatgatgacgaaaacgatttgtaa

DBGET integrated database retrieval system