KEGG   Citrus clementina (mandarin orange): CICLE_v100110482mHelp
Entry
CICLE_v100110482m CDS       T02982                                 

Definition
(RefSeq) hypothetical protein
  KO
K03252  translation initiation factor 3 subunit C
Organism
cic  Citrus clementina (mandarin orange)
Pathway
cic03013  RNA transport
Brite
KEGG Orthology (KO) [BR:cic00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    CICLE_v100110482m
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:cic03012]
    CICLE_v100110482m
Translation factors [BR:cic03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    CICLE_v100110482m
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF-3c_N PCI PLATZ
Motif
Other DBs
NCBI-GeneID: 18039344
NCBI-ProteinID: XP_006429957
UniProt: V4S6W7
Position
Unknown
AA seq 308 aa AA seqDB search
ERLERRRQMPYHMHINLELLEAVHLICAMLLEVPNMAANTHGAKSKVISKTFRRLLEVSE
RQTFTGPPENVRDHVMAATRALTKGDFQKAFDVINSLDVWRLLRNRESVLEMLKAKIKEE
ALRTYLFTFTSSYDSLSLDQLTKMFDLSEVQTHSIVSKMMINEELHASWDQPTRCIIFHD
VEHSRLQALAFQLTEKLSILAESNERAMESRTGGGLDLSLRRRDQDYAAGTGAMGGKWQD
NLSYNQGRQGRSGFTGGGGRSLALGQAGGYSRGQLRGSGGYSGRAAAARGSQMDGSNRMV
SLNKGVRV
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gaaaggctggaaaggagacgtcagatgccataccatatgcacataaatcttgagctcctg
gaggctgtccatctgatttgtgcaatgcttcttgaggtgcctaacatggcagccaatacc
catggtgctaagagcaaggtcataagcaagactttccgccggttgcttgaggtgagtgag
aggcaaacttttaccggcccccctgaaaatgtaagggatcatgtaatggcagccaccagg
gctctcaccaagggagacttccagaaggcttttgatgttatcaattctcttgatgtctgg
aggctactcaggaaccgggagagtgtgcttgagatgcttaaggccaagattaaggaagag
gctctgaggacgtacctttttaccttcacctcatcttatgattcactaagcttggaccaa
ctcacaaaaatgtttgacctttcagaagtgcaaactcacagcatagttagtaagatgatg
atcaatgaggaacttcatgcaagttgggaccagccgacccgttgcatcatcttccacgac
gttgagcactcaaggttgcaggctctggcattccagttaacagagaagctgtccatcctc
gctgaaagtaatgaaagagcaatggagtcaaggactggtggtggattggatctgtctctt
aggcggagagatcaagactatgcagctgggacaggtgctatgggtggcaagtggcaggac
aacttatcctacaatcagggaaggcaaggccgatcgggttttactgggggtggcggaagg
tcattggcactaggccaagccggtggttattctaggggccaactacgaggatctggtgga
tattctggaagggctgcagctgctaggggatctcaaatggatggttcgaaccgaatggtc
agtcttaacaagggagttcgggtttaa

DBGET integrated database retrieval system