KEGG   Citrus clementina (mandarin orange): CICLE_v10012005mg
Entry
CICLE_v10012005mg CDS       T02982                                 

Definition
(RefSeq) hypothetical protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
cic  Citrus clementina (mandarin orange)
Pathway
cic00100  Steroid biosynthesis
cic01100  Metabolic pathways
cic01110  Biosynthesis of secondary metabolites
Module
cic_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:cic00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    CICLE_v10012005mg
Enzymes [BR:cic01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     CICLE_v10012005mg
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 18038254
NCBI-ProteinID: XP_006430304
UniProt: V4UV28
Position
Unknown
AA seq 369 aa
MDLGFLLHAIIPSVDSAAILITFLTYLAIAGSILPGKVVPGAVLQDGTRLHYRCNGLFAL
TLLVALLGFGAYMNFISATVISDRGFELLSTTFIFSVLVTSALYVAGCRSRNKSSSLKPH
VTGNLIHDWWFGIQLNPQFMAIDLKFFFVRAGMMGWLLINLSVLAKSIQDGTLCRSMILY
QLFCAAYILDYFIYEESMTSTWDIIAERLGFMLVFGDLVWIPFTFSIQGWWLLHNQVELP
TATVIANCIIFLIGYMVFRGANKQKHVFKKNPKTHIWGKPPKVIGGKLLASGYWGMARHC
NYLGDLLLALSFSLPCGTSSLVPYFYPIYLVILLIWRERRDEARCAAKYREIWVEYCRLV
PWRILPYFY
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggatctgggttttcttttacacgctataattccttcagtagactccgctgctatattg
atcacattcttaacctacttggcaattgctggatctattttacccggcaaagttgttcct
ggcgctgtattacaagacggcactcgacttcattaccgttgcaatggtttgtttgcactc
acactgttggttgcgcttcttggttttggagcctatatgaatttcatatcagccactgtg
atatcagatagaggatttgagctgctatcgacaacttttatattcagtgttcttgtaaca
tcggcactctatgttgctggttgcaggtcacgcaataagagttcttcattaaagcctcat
gtcacaggaaatctaatacatgactggtggtttggcatacagctgaatcctcaatttatg
gccattgatctcaagtttttctttgttagagctggaatgatgggatggctacttatcaac
ttatcagttctggcaaaaagtattcaagatggcactttatgccgatcaatgatcctctac
caactattttgtgcggcgtacattctggactattttatttatgaggagtctatgacctcc
acgtgggacataattgctgagagattaggcttcatgttggtctttggagatctagtttgg
attcctttcactttcagcatccagggctggtggcttttgcataaccaggtggagctaccg
actgcaactgttatagctaattgcataatttttctaattggatatatggtattcagagga
gcaaataagcaaaagcatgtgtttaaaaagaatccaaaaactcatatatggggtaagccc
ccaaaggttattgggggcaagttgcttgcttctggttattgggggatggcaaggcattgt
aattaccttggggacttattgctggcactctccttcagtttaccttgtggaacaagttca
ctggttccatacttttatccaatttatcttgtaattctactaatatggagagaaagaaga
gatgaagctcgatgtgcggcaaagtatagagaaatatgggtcgaatactgtagacttgtg
ccatggagaatattaccatacttttactag

DBGET integrated database retrieval system