KEGG   Citrus clementina (mandarin orange): CICLE_v10014639mgHelp
Entry
CICLE_v10014639mg CDS       T02982                                 

Definition
(RefSeq) hypothetical protein
  KO
K09840  9-cis-epoxycarotenoid dioxygenase [EC:1.13.11.51]
Organism
cic  Citrus clementina (mandarin orange)
Pathway
cic00906  Carotenoid biosynthesis
cic01100  Metabolic pathways
cic01110  Biosynthesis of secondary metabolites
Module
cic_M00372  Abscisic acid biosynthesis, beta-carotene => abscisic acid
Brite
KEGG Orthology (KO) [BR:cic00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    CICLE_v10014639mg
Enzymes [BR:cic01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.51  9-cis-epoxycarotenoid dioxygenase
     CICLE_v10014639mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPE65
Motif
Other DBs
NCBI-GeneID: 18050641
NCBI-ProteinID: XP_006449708
UniProt: A0SE34
Position
Unknown
AA seq 609 aa AA seqDB search
MAASTTSPNSCSWGKSQILNPFSSSLVDMGFPTKSIALKKKPNKSLKVESALHSPSVLHF
PKQPYQNPVITRQDSTAKPENKSNKSQGQTQQSQWNPLQRAAAMALDMAENALVSRERQH
PLPKTADPRVQISGNFAPVPEWPVRHGLPVTGSIPECINGVYLRNGANPLFEPVAGHHFF
DGDGMVHAVTIGNGSASYACRFTETQRLMQERELGRPVFPKAIGELHGHNGIGRLLLFYA
RGLFGLVDHKQGTGVANAGLVYFNNRLLAMSEDDLPYQVRITPSGDLETVGRYNFNHQLK
STMIAHPKVDPVSKELFALSYDVVQKPYLKYFRFSADGDKSPDVEIHLPVPTMMHDFAIT
ENFVVIPDQQVVFKLQEMITGGSPVIYDKNKKSRFGILAKNAKDSNDIIWIESPDTFCFH
LWNAWEEPETDEVVVIGSCMTPADSIFNECDESLKSVLSEIRLNLKTGESTRRPILSESD
QVNLEAGMVNRNSLGRKTQFAYLAIAEPWPKVSGFAKVDLSSGEVKKYFYGDNKYGGEPF
FLPRDANNSENEDDGYILAFVHDEKTWKSELQIVNAMNLQLEASIKLPSRVPYGFHGTFV
DSKDLVNQA
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atggctgcttctactacatcacccaactcttgtagttggggtaaatctcaaattcttaac
ccattctcttcatctttggttgacatgggcttcccaacgaagtccatagccttgaagaag
aagcccaataaatccttgaaagtagaatctgccttacactctccttcagttcttcatttc
cctaaacagccttaccagaatcctgtaattaccagacaggactctacagcaaaacccgaa
aacaagagcaacaaaagccaaggacaaacacagcaatcacaatggaatcccctccaaaga
gccgctgccatggccttggacatggcggagaacgcgttggtctcacgagagcgccaacac
ccacttcccaaaacagccgacccacgtgtccaaattagcggtaacttcgctccggtgccg
gaatggcccgtccggcatggtctcccagtcactggctccatccccgaatgcatcaacggc
gtttacctccgcaacggtgccaacccattattcgagccggttgccggtcaccatttcttt
gacggtgacggcatggtccatgcagtcaccatcggaaacggaagcgcaagttacgcttgt
cgtttcacagagacacagagattaatgcaggagagagaattagggcgtcctgtttttcca
aaagcaataggcgaattacacggacacaatggtattgggcgtctcttgcttttctacgca
agaggattgttcggactcgttgatcataaacaaggcactggtgtggcaaacgctggctta
gtttacttcaataacaggcttttagcaatgtccgaagatgatcttccataccaagtacgc
atcactccttctggggatcttgaaaccgttgggcgttacaattttaaccaccaacttaag
tcaacaatgatagctcatccgaaagttgatcccgtatcaaaggagctttttgctttgagt
tatgatgttgttcaaaagccttatttaaaatactttagattttctgctgatggagacaaa
tcacccgacgtagagattcatctgccagtgcccaccatgatgcacgatttcgctatcact
gagaattttgtggtgatcccggaccaacaagtcgttttcaagctccaagaaatgataacg
ggtggctctccggtgatttatgacaagaacaagaagtcccggttcgggattcttgcaaag
aatgctaaagattctaacgacatcatctggattgaatcaccggacacgttctgctttcac
ttgtggaacgcttgggaggagccggaaactgatgaagttgttgtcattggatcatgcatg
acacctgctgactcaattttcaacgagtgtgacgagagtctgaagagcgttttatccgaa
attcggctcaatttaaagactggtgagtccacgcgccgcccgattctctcggagtctgat
caagtgaacttggaggctgggatggtgaatcgcaacagccttggtagaaaaactcagttc
gcttatctagcgattgcggagccatggcctaaagtttcaggttttgctaaagtggatctc
tcttcaggagaggttaaaaagtatttttacggcgataataaatatggcggcgagccattt
ttcttgccaagagatgctaataattctgaaaatgaagacgatggttatattcttgcattt
gttcatgacgagaagacttggaaatcagagctgcaaattgtgaatgccatgaatttacag
cttgaagcttcgattaagttaccttcgagagtaccatacggttttcatggaacttttgtt
gactccaaggacttggtgaatcaagcataa

DBGET integrated database retrieval system