KEGG   Citrus clementina (mandarin orange): CICLE_v10017539mgHelp
Entry
CICLE_v10017539mg CDS       T02982                                 

Definition
(RefSeq) hypothetical protein
  KO
K09338  homeobox-leucine zipper protein
Organism
cic  Citrus clementina (mandarin orange)
Brite
KEGG Orthology (KO) [BR:cic00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cic03000]
    CICLE_v10017539mg
Transcription factors [BR:cic03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, HD-ZIP
    CICLE_v10017539mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HALZ Homeodomain Homeobox_KN YjbH Fungal_TACC bZIP_1 YabA ZapB DUF3584 Atg14 Cdh1_DBD_1
Motif
Other DBs
NCBI-GeneID: 18050973
NCBI-ProteinID: XP_006446470
UniProt: V4U6L4
Position
Unknown
AA seq 284 aa AA seqDB search
MESGRLFFDRSSCPGNMLFLGNGDSFFGGARSMMSMEETSKRRPFFSSPDDLFDDCYYDE
QLPEKKRRLTAEQVHLLEKSFEAENKLEPERKGQLAKKLGLQPRQVAVWFQNRRARWKTK
QLERDYDLLKSSYDALLSSYDSLVKENQKLKSEVVSLNEKIEAKEEESKEAKSDKKTETH
HQPTEVTNNICGIQLQLSNNKTEDRLSSGCSGESAVVDEDGPQRVVDTGDSYFGCMDPVV
DAAQSEEDGGSDDGRSYFSDVLVVAPDHVSNQQHEEPLGWWVWS
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggagtctggacgtttgttcttcgatcgctcatcttgccccgggaatatgttgtttctt
ggaaacggtgattccttttttggaggagcgagatcgatgatgagcatggaggaaacctca
aagaggcgaccttttttcagctcaccggatgacttgttcgacgactgctattacgacgaa
cagttgccggagaaaaagcgccgcctcactgctgagcaggtgcatctgctggagaaaagc
tttgaggcagagaacaagctggagccggagaggaaaggccagttggcaaagaagctggga
ttgcagccaagacaagtagcagtgtggttccagaaccgccgtgctcggtggaagacaaag
caacttgaaagggactatgatctcctcaaatcttcttatgatgctctcctttctagctat
gactctcttgtgaaggagaatcagaagctcaaatccgaggtggtttctttgaatgagaaa
attgaagccaaagaagaagaaagcaaagaagccaaatcagacaaaaagaccgagactcat
catcagccaacagaagtgacaaataatatttgtggcatccagctccagctgagcaataat
aagactgaagatcggctaagttctggctgcagtggtgaaagtgcggtggtggatgaagat
gggccccagcgggtggtggacactggtgattcatactttggatgcatggaccccgtcgtc
gatgccgcccaatcggaggaggacggcggcagtgatgatggccggagttatttctccgat
gtgttggtggtggcaccagatcatgttagcaatcaacagcatgaggagcctttgggttgg
tgggtttggtcataa

DBGET integrated database retrieval system