KEGG   Citrus clementina (mandarin orange): CICLE_v100182712mHelp
Entry
CICLE_v100182712m CDS       T02982                                 

Definition
(RefSeq) hypothetical protein
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
cic  Citrus clementina (mandarin orange)
Pathway
cic00460  Cyanoamino acid metabolism
cic00500  Starch and sucrose metabolism
cic00940  Phenylpropanoid biosynthesis
cic01100  Metabolic pathways
cic01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CICLE_v100182712m
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    CICLE_v100182712m
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    CICLE_v100182712m
Enzymes [BR:cic01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     CICLE_v100182712m
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-GeneID: 18051808
NCBI-ProteinID: XP_006445677
UniProt: V4TZ69
Position
Unknown
AA seq 278 aa AA seqDB search
MIYKDPKQPVEVRVKDLLSRMTLAEKIGQMTQIERVNATFDAMKNYFIGSVLSGGGSVPS
PNATAQQWIDMVNDIQRGAMATRLGIPMIYGVDAVHGHNNVYKATIFPHNVGLGATRDPN
LVKRIGAATALEVRATGIPYAFAPCIAVCRDPRWGRCYESYSEDAKLVQQFSVIISGLQG
DAPSKQVKKGRPFVGGKDKVAACAKHYVGDGGTVNGINENNTIVTTEQLFDIHMPPYWSA
LDQRVSTVMISYSSINGKKMHANKELVTEYLKERLKFK
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgatatacaaagatccaaagcagccagtggaggttagggtgaaggacttattgagcaga
atgactcttgcggagaagattgggcagatgacccaaattgaaagggttaatgccactttt
gatgcgatgaagaattacttcatcggaagtgttttgagcggcggagggagtgtgccatct
ccaaatgcaacagcgcagcaatggattgatatggttaatgatattcagagaggagctatg
gcaacacgtcttggcatcccaatgatttatggagttgatgctgttcatggacacaacaac
gtgtataaagctacaattttcccacataatgtcggccttggagccaccagagatcctaat
cttgttaagagaattggtgctgcaactgcacttgaagttcgagcaactggcattccatat
gcctttgccccatgtatcgcggtttgcagagatcctaggtggggaaggtgctatgagagt
tacagtgaggacgcaaaacttgttcagcagttttctgttatcatctctggattacaagga
gatgcaccaagcaagcaagtcaagaaaggtagaccttttgttggtggaaaggacaaggtg
gcagcttgcgcaaagcactatgttggggatggtggcacggttaatggcattaatgaaaat
aacaccattgtcaccacagaacaactgttcgatattcacatgcctccttactggagtgcg
ttggatcaacgcgtctccactgttatgatttcgtattccagtattaatggaaaaaagatg
catgctaacaaagaattggttactgagtatctcaaggaaaggctaaagttcaag

DBGET integrated database retrieval system