KEGG   Citrus clementina (mandarin orange): CICLE_v10018742mgHelp
Entry
CICLE_v10018742mg CDS       T02982                                 

Definition
(RefSeq) hypothetical protein
  KO
K17108  non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
cic  Citrus clementina (mandarin orange)
Pathway
cic00511  Other glycan degradation
cic00600  Sphingolipid metabolism
cic01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cic00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CICLE_v10018742mg
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CICLE_v10018742mg
Enzymes [BR:cic01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     CICLE_v10018742mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF608 Glyco_hydr_116N Bac_rhamnosid6H EF-hand_5 EF-hand_1
Motif
Other DBs
NCBI-GeneID: 18046848
NCBI-ProteinID: XP_006441653
UniProt: V4T3W1
Position
Unknown
AA seq 944 aa AA seqDB search
MENGVKEEGENAASMPKVDPGQPPQLTWQRKLDSNVKVPTGFTLSFQEFRHLAHIGFRLY
RYSKQEEAKGKVPVFNVFRKHHITSDQGIPLGGIGAGSIGRSYRGEFQRFKLFHGICDDA
PVLANQFSVFVSRPNGEKFSSVLCPRSPGVPKKNTDSGIESWDWNLKGENCTYHALFPRA
WTVYDGEPDPELRIVCRQISPFIPHNYKESSFPASVFTFTLSNSGQTCADVTLLFTWANS
VAGDSGLSGHHFNSKTMTKDGVHGLTLHHRTANGRPPVTFAIAAEETADVHVSECPCFLL
SGNSKGITAKDMWNEIKKHGSFDHLDNDKTSPSEPGSSIGAAIAASLTIPSGSTRSVTFS
LAWDCPEVKFFEKVYHRRYTKFYGTLGDSAARIARDAILEHAKWECEIEAWQRPILEDKR
FPEWYPITLFNELYYLNAGGTIWTDGSPPMQSLATIRERKFSLDTPRSDNKNIFCADDEN
DTANGILGRMTSTLEQIHTPASSDTALGTRLLENGEENIGQFLYLEGAEYVMYNTYDVHF
YSSFALVMLFPKLELSIQRDFAAAVMMHDPGTMKIMSDGKWVARKFLGAVPHDIGLDDPW
FEINSYNLFNSSRWKDLNSKFVLQVYRDFVATGDKTFARAVWPSVYIAMAYMEQFDKDGD
GMIENEGFPDQTYDAWSANGVSAYCGGLWVAALQAASALANDVGDHASASYFWVRYQKAK
AVYDSLWNGSYFNYDNSDGSSSTSIQADQLAGQWYARACGLLPIADEAKVKKALTKIYDF
NVLKVKGGMCGAMNGMQPDGRIDMSGLQAREIWPGVTYGLAASMIQEEMVDMAFQTAAGV
YEVAWSEDGLGYSFQTPESWNNNDEYRSLCYMRPLTIWAMQWALTKPKLSRQEIKHEISD
RDSSYLEQHAAFSKVASLLKLPKEEASKGFLKVVYDFTIGRVLW
NT seq 2835 nt NT seq  +upstreamnt  +downstreamnt
atggagaacggtgtcaaagaagaaggagaaaatgcagcatccatgcccaaggttgacccg
gggcaacccccccagttgacatggcagcgaaaactggattctaatgtaaaagtcccaacg
ggattcactctaagttttcaagagtttaggcatttggcacatatagggtttagactatat
cgttatagcaagcaagaagaagcaaaaggaaaggtgccagttttcaatgttttcagaaag
catcatattaccagtgatcaaggcattcccttaggtggtattggtgcaggaagcattgga
agaagttacagaggcgagtttcaacgcttcaaactgttccacgggatttgtgatgatgcc
ccagttctggcaaatcaattttctgttttcgtttcacgcccaaatggagaaaagttttcc
agtgtattatgcccgaggagtccaggggtccccaaaaaaaatacagactctggcattgaa
tcttgggattggaatctgaagggtgaaaattgtacctatcatgctttgtttccgagggct
tggacagtctatgatggggaacctgatccagaacttagaattgtttgtcgtcaaatttca
ccttttattccccataattacaaagagagcagtttccctgcatcagtatttacattcacg
ctatctaattcaggacaaacctgtgcggatgtcacattgctttttacttgggctaattct
gttgctggagactctggattatctggtcatcacttcaattcaaagacaatgacaaaggac
ggagtgcatggattaactttacatcatagaacggcaaatggacgtcctccagtaactttt
gccattgcagcagaggaaacagctgatgttcatgtctctgagtgcccttgcttcttgtta
tctggtaattccaaaggaatcacagctaaagacatgtggaatgaaataaaaaagcacgga
tcatttgaccaccttgacaatgataaaacgtcaccttcggaaccaggatcgtccattgga
gcagccatagcagcctctttaactattccttctggatctacccgtagtgtcacattttca
ttggcgtgggactgtccagaagtcaaattttttgaaaaggtgtaccacaggcgttatacg
aaattttatggcactctaggggattcagcagctagaattgcacgtgatgccatccttgag
catgctaaatgggaatgcgagatagaagcatggcaaagaccaattcttgaagacaaaagg
tttcctgaatggtacccaatcactctttttaatgagctttattatctcaatgctggagga
actatttggacagatggctcacctccaatgcaaagtttggcaaccattagggaaagaaaa
ttttctcttgatactccaaggtcagataataagaatattttttgtgcggacgatgaaaat
gacactgctaatggaatccttggaaggatgacatctacgcttgagcaaattcatactcca
gcatcatctgatactgctcttggaacccgtttacttgaaaatggagaagaaaatattggt
cagttcctgtaccttgaaggggctgaatacgtcatgtataatacatacgatgtccatttc
tattcatcttttgcactggtcatgctattccccaaactagaacttagcattcagagagac
tttgcagcagcagtaatgatgcatgatcctggtacaatgaaaattatgagtgatggaaag
tgggttgctcgaaaatttctcggtgctgttccccatgatattgggcttgatgacccatgg
tttgaaataaatagttataacctgttcaattcatctcggtggaaagacttgaattctaaa
tttgttctccaagtttacagggattttgtagccactggtgataaaacttttgcaagggct
gtttggccctcggtttatattgctatggcttatatggaacagtttgataaggatggggat
ggaatgattgagaatgaagggtttcctgatcagacttatgatgcatggtcagctaacggg
gtcagtgcttattgcggtgggctgtgggtggctgcccttcaggctgcctcagccttggca
aatgacgttggtgaccatgcatctgccagttacttctgggttagatatcagaaagcaaaa
gctgtatatgacagtctatggaatggttcctactttaattatgacaacagtgatggtagt
tcaagcacatccattcaggccgatcaattggctgggcaatggtatgcaagagcatgcggt
cttttgccaattgctgatgaagctaaagtgaagaaagcacttacgaaaatttacgacttc
aatgtcttaaaggtgaaaggaggaatgtgtggagcaatgaacggtatgcaacctgatgga
agaattgatatgtctggcttgcaggcaagagaaatatggcctggagttacatacggcctt
gctgcttctatgattcaagaggagatggtggatatggcatttcagacggctgctggtgtc
tatgaagtagcttggtccgaagatggtcttggatactcttttcagactccagaaagttgg
aacaacaatgatgagtacagatctctctgttatatgcggccgttgaccatatgggcaatg
cagtgggctttgacaaagccaaagctgagcaggcaagagataaaacatgagataagtgat
cgggattcttcatacttggagcaacatgccgcattttcaaaagtggcttctctgttaaag
ttgccgaaggaggaagcttccaaaggcttcctaaaggttgtttatgacttcacaatcgga
agagttctttggtaa

DBGET integrated database retrieval system