KEGG   Citrus clementina (mandarin orange): CICLE_v10019590mgHelp
Entry
CICLE_v10019590mg CDS       T02982                                 

Definition
(RefSeq) hypothetical protein
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
cic  Citrus clementina (mandarin orange)
Pathway
cic00860  Porphyrin and chlorophyll metabolism
cic01100  Metabolic pathways
cic01110  Biosynthesis of secondary metabolites
Module
cic_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:cic00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CICLE_v10019590mg
Enzymes [BR:cic01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     CICLE_v10019590mg
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     CICLE_v10019590mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO NAD_binding_9 Thi4 Pyr_redox_2 Lycopene_cycl FAD_oxidored
Motif
Other DBs
NCBI-GeneID: 18047003
NCBI-ProteinID: XP_006444624
UniProt: V4VWZ0
Position
Unknown
AA seq 545 aa AA seqDB search
MPTLTFTDISLLRPTPSLFPCPLKPTEKLRIHRLPLKLRCSIAEESKISPSKLSPNLNAA
DAATADCVIIGGGISGLCIAQALATNHSAVAPNVIVTEARDRVGGNIITVERDGYLWEEG
PNSFQPSDPMLKMVVDSGLKDDLVLGDPNAPRFVLWNGRLRPVPSSPTDLPIFDLMSIGG
KIRAGLGALGLRPPPPGHEESVEEFVRRNLGDEVFERLIEPFCSGVYAGDPSKLSMKAAF
GKVWKLEQTGGSIIGGTFKAIQEKNKAPKQPRDPRLPKPKGQTVGSFRKGLTMLPEAISK
RLGSKVKLSWKLSGVKKLDSGEYSLTYETPEGLVSLRSRSVVMTVPSYVASSLLRPLSVD
AAGALSQFYYPPVAAVSVSYPKEAIRTECLIDGELKGFGQLHPRSQGVETLGTIYSSSLF
PNRAPAGRVLLLNYIGGATNLGILSKKESELVEAVDRDLRKMLINPNAKDPLVLGVRVWQ
QAIPQFLVGHLDLLDAAKSSLRDNGYQGLFLGGNYVAGVALGRCVESAYEVASEVSNFLS
QYAYK
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgccgacgttgacattcacagacatctcgcttctccggccgacaccatctctattccct
tgtcccttaaaacccaccgaaaagctccgcattcaccgactacccctcaaacttcgatgc
tcaatcgccgaagaatccaaaatttctccatctaagttgagcccaaatctcaacgctgca
gatgccgccacggcagattgtgtgattattggcggtggaatcagtggcctctgcatcgcc
caggcactcgccaccaaccacagcgctgttgctccaaatgtgattgtcaccgaggctaga
gatcgagttggtggaaacatcatcactgttgagagagatggatatctctgggaagagggg
cccaacagtttccagccctctgatcccatgctcaaaatggtggtggatagtgggttgaag
gatgatctagttttgggggacccaaatgcaccgagatttgtattatggaatgggagattg
aggccagtaccatctagtccaacagaccttcctatctttgatttgatgagcatcggaggg
aaaattagggctggccttggtgctcttggccttcgacctcctcctccaggtcacgaggaa
tcagttgaggagtttgtgcggcgtaaccttggtgatgaggtttttgagcgtctaattgag
ccattttgttcaggggtttatgcaggagatccttcaaaactaagcatgaaagcagcattt
ggaaaggtttggaaactggagcagactggtggcagtatcattggtggaacttttaaggca
atccaggaaaaaaataaagctcctaagcaacctcgagacccgcgtctaccaaagccaaag
ggccaaacagttggatcttttaggaagggacttactatgctgccagaggcaatatctaaa
aggttaggtagcaaagtcaaattatcttggaagctttcaggggtcaagaaattggatagc
ggagagtatagtttgacttatgaaacacctgaaggattggtttctctgcggagcagaagt
gttgttatgacagttccatcttatgtcgctagtagtctactacgtccactttctgtagat
gctgccggtgcactctcacaattttactacccaccagttgctgcggtgtctgtttcttat
ccaaaagaagcaattcggacagagtgcttgatagatggtgaattaaaagggtttggccaa
ttgcatccacggagccaaggggtggaaacattaggaacaatatatagctcatcacttttt
cccaaccgagcaccagctggaagggttttgctcttaaactacattggaggtgctacaaat
cttggaattttgtccaagaaggagagcgagcttgtagaagcagttgaccgcgacttaaga
aagatgcttataaatcctaatgctaaagatccacttgtattgggtgtgagagtgtggcaa
caagccattccacagttcttggttggtcatcttgatctcttagatgctgcaaaatcttct
ctgagagataatggatatcaagggctatttttagggggaaactatgtagctggtgtggct
ttgggtcgatgtgtggagagtgcttatgaggttgcatccgaggtttccaattttctatca
cagtatgcatacaaatag

DBGET integrated database retrieval system