KEGG   Citrus clementina (mandarin orange): CICLE_v10019772mgHelp
Entry
CICLE_v10019772mg CDS       T02982                                 

Definition
(RefSeq) hypothetical protein
  KO
K17890  autophagy-related protein 16-1
Organism
cic  Citrus clementina (mandarin orange)
Pathway
cic04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:cic00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    CICLE_v10019772mg
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cic04131]
    CICLE_v10019772mg
   03029 Mitochondrial biogenesis [BR:cic03029]
    CICLE_v10019772mg
Membrane trafficking [BR:cic04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    CICLE_v10019772mg
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    CICLE_v10019772mg
Mitochondrial biogenesis [BR:cic03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    CICLE_v10019772mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ATG16 ANAPC4_WD40 Nup160 Cytochrom_D1 GOLGA2L5 Ge1_WD40 PQQ_2 DUF5046 Exonuc_VII_L YlqD Hormone_1 DUF2383 GCD14 Phlebovirus_NSM DUF4854 V_ATPase_I
Motif
Other DBs
NCBI-GeneID: 18047591
NCBI-ProteinID: XP_006439984
UniProt: V4VKJ3
Position
Unknown
AA seq 510 aa AA seqDB search
MSKEEIAREAIKHALKALRKRHLVEEGAHAPAIIALSRPIISQGSEWKEKADNLETELQQ
CYKAQSRLSEQLVVEVAESRSSKALLQEKESLITSLQEELTQIRDECSQLKTELEEKIKA
LELVVSENQQIRAQLEEMTMKAKNAEAENKMLVDRWMLQKMQDAERLNEANALYEDMIDR
LKASGLEKLAKQQVDGVVRRSEEGAEFFAESTVPSTCKHKINAHEGGCASILFEYNSARL
ISGGQDKSIKLWDTNTGSLSSTLYGCLGSVLDLAITHDNRSVIAASSSNNLYVWDVNSGR
VRHTLTGHTDKVCAVDVSKISSRHVVSAAYDRTLKVWDLHKGYCVNTIIFHSNCNALAFS
MDGQTIFSGHIDGNLRLWDIQTGKLLSEVAAHSLAAVTSISLSRSGNIILTSGRDNLHNL
FDIRSLEVCGSLRATGNRVASNWSRSCISPDESYVAAGSADGSVYIWSISKADIVRTLKE
HTAPVLSCSWSGLGKPLASADKNGVVCVWT
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagaggaaattgctagggaagctataaagcacgctctcaaggcgttacggaaa
cggcatttagtagaagaaggcgctcatgctcccgccattattgctctttcaaggccgatc
atttctcagggatccgaatggaaggagaaagcggataatctggaaacagagcttcagcaa
tgttacaaagctcaatctaggttatcagagcagcttgtggttgaagtagctgagtctaga
tcttctaaagctttattgcaagagaaagaatcactgattacttcactacaggaagaattg
acgcagataagggatgaatgttctcagttgaagacggaattggaagaaaagatcaaggcc
ttggaattagttgtgagcgagaaccagcaaatcagagcacagctagaagagatgactatg
aaagctaaaaatgctgaagctgaaaataaaatgttagttgatagatggatgttgcaaaag
atgcaggacgctgagcggctaaatgaggcaaatgcactttatgaagatatgattgatcgg
ctcaaggccagtgggttagagaaacttgctaaacagcaggtagatggtgtggttcgccga
agtgaagaaggtgctgagttctttgcggagtcaactgttccatctacatgcaaacataag
atcaatgcccatgaaggtggctgtgcatccatattgtttgaatacaattctgccagattg
attagtggtggacaggacaagtcaattaaattgtgggatacaaacactgggtcattaagc
agtaccctctatggttgccttggctcagttcttgatcttgctattacccatgataataga
tctgtcattgctgcaagtagctcaaacaacttgtatgtttgggatgtcaactcagggcgt
gtccgtcatactctcacaggtcacacagataaagtgtgtgctgtagatgtgagcaaaatt
tcaagccggcatgtcgtaagtgcagcttatgatcgtactttaaaagtgtgggatttgcat
aaaggttactgtgttaacacaatcatttttcacagcaactgtaatgctcttgccttcagt
atggatggacagaccatattttctggtcatattgatgggaatctgcgtttgtgggatatt
caaacaggaaagctacttagtgaagttgccgcacattcacttgctgcagttacatctatc
tctttgtcgcgaagtggaaacataatactaactagcgggcgagacaacttgcacaactta
tttgatatacggtctttagaagtttgtggctcactaagagcaactggaaacagagtggca
tctaattggagccgatcctgcataagtccggatgagagctatgttgctgctggctcagct
gatggatctgtatatatctggtcaatatctaaagctgatatagtgagaacgttgaaggag
cacacagctcccgtgctgagttgttcatggagtgggcttggaaaacctctggcctctgct
gacaagaatggagttgtttgtgtttggacgtga

DBGET integrated database retrieval system