KEGG   Citrus clementina (mandarin orange): CICLE_v10025043mgHelp
Entry
CICLE_v10025043mg CDS       T02982                                 

Definition
(RefSeq) hypothetical protein
Organism
cic  Citrus clementina (mandarin orange)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr GUB_WAK_bind EGF_3 EGF
Motif
Other DBs
NCBI-GeneID: 18037013
NCBI-ProteinID: XP_006425789
UniProt: V4SJK1
Position
Unknown
AA seq 692 aa AA seqDB search
MIPQLSLSLLISICILYLANAADLCDRTCRNGKSTKRVPYPFGFSPGCAIRLTCANATVK
IGEFEVQNVTADSIFVNLPTKCHRQITSLHPLFGPNYGMTRQNSLLLQNCTTHQNGCVIP
TSLVEQRFNLKTCGVGSDNITCFSWPYNENKSASFMSFNDLSRTGCNYLFSSLAFNSGGN
SAGSLEFQLLELGWGLNGSCNCSKNADCTPNVTLANGISGHRCRCQEGFEGDGFVAGDGC
RRTSDCSASKYLSGKCGGTRIGALVGGLIAGASIVAVVALLCYCFRKRSTSLRNQLSAKR
LLCQAAGNSSVPFYPYKEIEKATSFFSEKHRLGTGAYGTVYAGKLHNDDWVAIKRFRYRD
TDSIDQVMNEIKLLSSVSHPNLLRLLGCCIEEGEPILVYEFMPNGTLCQHLQRERGSGLP
WTIRITIATETAQAIAYLHSAMNPPIYHRDIKSSNILLDYNYRSKVADFGLSRLGMTESS
HISTAPQGTPGYLDPQYHQYFHLSDKSDVYSFGVVLIEIITALKVVDFSRPHSEVNLAAL
AIDRIGRGCVDEIIDPYLEPHRDAWTLSSIHNVAELAFRCLAFHRDMRPSMMEVAEELEH
IRVSSWASNIYMGSPPVSCCSLSECGSQRSLSGLTVKKAGVKSQRLVVPPKSGDCLTTLD
EVKDSSPVSVQDPWLSEQSSPSTNSLLGNVVQ
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgattcctcaactaagtttatctcttctcatctccatctgtatactctatcttgctaac
gccgccgacttgtgcgaccgcacctgtaggaacgggaaatcaactaaacgcgtgccgtac
ccgttcggattctcaccgggttgcgcgatccgtttaacctgtgcgaacgcaaccgtgaaa
atcggagagtttgaggtccaaaacgtgacggcggacagcatcttcgtcaaccttcccaca
aaatgccaccggcagattacgtcactccatccgctgttcggtcccaactacgggatgacg
cggcagaacagcctgcttcttcagaactgtacgactcatcaaaacggctgcgttataccg
acgagtttggtcgagcaacgcttcaatctaaagacgtgtggtgttggtagcgataatata
acgtgtttctcttggccatacaacgaaaataagagtgcgagtttcatgagctttaatgac
ttgagtcggactgggtgcaactatctgttttcatcgttggcttttaactcaggcggaaac
tcggccgggtcgctcgagtttcagctattggagctgggttgggggcttaatggctcctgc
aattgctctaaaaatgccgattgtactcctaatgtcacgctcgccaacggaatttctggg
caccgttgccggtgtcaggaaggttttgaaggtgatggtttcgtagccggtgatggatgc
cggagaacttctgactgcagtgcttcaaagtatttatctggcaaatgtggggggactaga
attggtgctcttgttggagggcttattgctggagcttccatagtggctgttgtggctctt
ctatgttactgcttccgaaagcggtccacttctttgagaaaccagctgagcgcaaagcgc
cttctgtgtcaagcagctggcaactctagtgtacccttttacccttacaaagaaattgaa
aaagccaccagttttttctctgaaaaacataggctgggaactggtgcctatggtacagtt
tatgcagggaagctccacaatgatgattgggttgccataaaaaggtttagatatcgagac
actgacagtattgaccaagttatgaatgagattaagcttctctcctctgtgagccaccca
aatctacttcgactcctaggttgctgcatcgaggaaggtgagcctatacttgtttatgaa
tttatgcccaatggtactctgtgtcagcatctgcaaagagagagaggaagtggacttcct
tggacaatacggattaccatagccactgagactgctcaagcaattgcctatcttcactca
gctatgaatccaccaatttaccaccgagacatcaaatccagcaatatactattggattac
aactataggtcaaaggtagcggattttgggctttccagacttggcatgactgagtcatct
cacatctcaactgctccacaaggaactccaggctaccttgatcctcaataccatcagtat
ttccatctttctgacaaaagtgatgtttacagttttggggtagttcttattgagatcata
actgcactgaaagtggttgatttttctcgccctcacagtgaggtgaatttggctgcactt
gctattgataggattggaagaggttgtgtggatgagataatagatccataccttgagcca
catagggatgcgtggacactctcatccattcacaatgttgctgagctagcatttagatgc
cttgcatttcatagggacatgaggccttctatgatggaagtggcagaagagctagaacac
atcagggtcagttcatgggcttcaaatatttatatgggctcacccccagtgtcttgttgt
tcattatcggaatgcggaagtcagagatcactgagtggcttgacagttaagaaggcaggg
gttaagagtcagaggttggttgttccccctaaatctggtgattgtctgactacattggat
gaggtgaaggatagctcccctgtttctgtacaggatccttggttaagcgaacagagctca
ccttccacaaacagcttgttgggtaatgtagtgcaatga

DBGET integrated database retrieval system