KEGG   Citrus clementina (mandarin orange): CICLE_v100304921mHelp
Entry
CICLE_v100304921m CDS       T02982                                 

Definition
(RefSeq) hypothetical protein
  KO
K14759  isochorismate synthase / 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase / 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase / O-succinylbenzoate synthase [EC:5.4.4.2 2.2.1.9 4.2.99.20 4.2.1.113]
Organism
cic  Citrus clementina (mandarin orange)
Pathway
cic00130  Ubiquinone and other terpenoid-quinone biosynthesis
cic01100  Metabolic pathways
cic01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cic00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    CICLE_v100304921m
Enzymes [BR:cic01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.9  2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase
     CICLE_v100304921m
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.113  o-succinylbenzoate synthase
     CICLE_v100304921m
   4.2.99  Other carbon-oxygen lyases
    4.2.99.20  2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
     CICLE_v100304921m
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.4  Transferring hydroxy groups
    5.4.4.2  isochorismate synthase
     CICLE_v100304921m
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MR_MLE_C Abhydrolase_1 Abhydrolase_6 Hydrolase_4 BAAT_C Abhydrolase_2 Ndr Abhydrolase_3 DLH Thioesterase Lipase DUF2974 LIDHydrolase Chlorophyllase Esterase DUF726
Motif
Other DBs
NCBI-GeneID: 18044044
NCBI-ProteinID: XP_006437819
UniProt: V4VEZ8
Position
Unknown
AA seq 800 aa AA seqDB search
LNHVQVKTKVELEEALSMSQHLGTDRVIEVESCIDANATFHSMLRKFARQSADHTLNVLS
QFSVPVTISCSLSICKICRMEYSLYRIQLCAPPTSSYIDHNRSRFCREGFILSLYLEDGS
VGYGEVAPLEIHKENLLDAEEQLRFLLHFMTGAKISYFLPLLKGSFSSWIWSTLGIPACE
IFPSVRCGLEMAILNAIAVKHGSSFLNILYPLTEIDEEISKRSTSIKICALIDSNKSPVE
VASIATTLVEEGFTAIKLKVARRADPIKDAEVIQEVRKKVGHRIELRVDANRNWTYQEAL
EFGFLVKDCDLQYIEEPVQNEEDIIKYCEESGLPVALDETIDKFQKDPLNMLEKYAHPGI
VAIVIKPSVIGGFENAGLIARWAQRHGKMAVVSAAFESGLGLSAYIIFSSYLELQNAYLC
KVMNRELCPPVAQGLGTYQWLKEDITTDPISICHNSCSGFVEASVAKATHILQNLQINND
VICKTSMEEQVLRYQLNVNSKDFCSFIKVQEIGQRIDIQDNILLFLHGFLGTGEEWIPIM
KAVSGSARCISIDLPGHGGSKMQNHVAKATQEITLSIDVIADVLYKLIEQITPGKVTLVG
YSMGARIALYMALRFSDKIKGTVIISGSPGLRDNIARKIRRAEDDSRACALVTHGLQVFL
DTWYTGELWESLRSHPHFNRIVASRLLHEDVQSLSKALSDLSVGRQPPLWEDLKLCSTPL
LIVVGEKDKKFKSIAEKMCYELSHDEKGSDDLRNQIYEMVEIPNCGHAVHLENPLPVIRA
VRQFLTRVNQNSTSNPESNG
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
ttaaatcacgtacaagtgaagacaaaagtagaacttgaggaggctttatccatgtcccag
catctcgggacggatcgtgtcattgaagttgagagctgcattgatgccaatgccacattc
cacagtatgttaagaaaatttgcacgccaatcagcagatcatactttgaacgtcctttca
cagttttctgttccagttactatttcatgtagtctctctatttgtaagatctgtagaatg
gaatattctctgtataggattcaactttgcgcacctcctacgtcaagttatatcgatcat
aatcgaagtagattctgtagagaaggttttattttatcgttgtatcttgaagatgggagt
gtcgggtatggtgaggttgcacctcttgaaatccacaaggaaaacctgctggatgcagaa
gagcaacttcgctttcttcttcattttatgacaggagctaaaatcagttattttctacct
ctgctgaagggctcattttcttcatggatatggagcacattaggaatacctgcatgtgaa
atatttccgagtgtcagatgtggtttggaaatggctatcctcaatgccattgcagtaaaa
catggttccagtttcttgaacattctctatcccctgacagaaatagatgaagaaatatct
aaacggtcaacaagtataaagatatgcgccctcattgattcgaataaatctcctgtggag
gttgctagcattgctaccactcttgtggaagaagggttcactgcaatcaaactcaaagtt
gcacgccgggcagatcccattaaagatgcagaagttatacaagaagtaagaaagaaggtt
ggtcacaggattgaactccgtgtggatgccaatcgtaactggacctatcaagaagctctt
gaatttggtttcttagttaaagattgtgacttgcaatatattgaggagcctgttcagaat
gaagaggatattataaagtactgtgaagaaagcggcttgcctgtagcgttggatgaaacc
attgacaaattccaaaaagatcctcttaatatgcttgagaagtatgctcacccaggaata
gttgctattgtgatcaaaccaagtgtcattggtggatttgaaaatgcaggattaattgca
agatgggcccagcgacatgggaagatggctgttgtcagtgctgcctttgaaagtggtcta
ggtttgtcagcatatatcatattttctagctatctggagctgcagaatgcatatttatgc
aaagtgatgaatcgtgaactgtgcccccctgtagcccaaggtcttggaacttatcagtgg
cttaaagaagacataacaactgatcctatcagtatttgtcataattcgtgtagtggcttt
gtagaagcatctgttgctaaagctacccacatcctgcagaacttacaaattaataatgac
gttatatgtaaaacttccatggaggagcaagttttgagataccaattgaatgtgaattca
aaggatttctgcagtttcatcaaagtgcaagagattggacaaagaattgatatacaggat
aacatacttctgtttctccatggctttcttggaactggtgaagaatggattcctattatg
aaggccgtctcaggatcagcaagatgcatctcaattgatctccctggtcatgggggatca
aagatgcaaaatcatgttgctaaagccacacaggaaataactttgtcaatagacgtcatt
gcggacgtactatataagctgattgaacagattactcctggaaaagttactctagttggg
tattctatgggagcaagaattgccttgtatatggccctgagattcagtgataagatcaaa
ggaaccgttataatatctggaagtccagggctacgagataatatagcaagaaaaattcgt
agggctgaagatgattctagagcgtgcgcccttgtcactcatggtctgcaagtctttcta
gatacctggtatactggggagctctgggaaagcttgagaagccatccccattttaatcga
atagttgccagccgcttgttgcatgaagatgtgcagagtctttcaaaagctctgtcagat
ttaagtgttgggagacagccgccattgtgggaagatttgaagctatgcagcacacctctc
ttgattgttgtcggagagaaagataagaaattcaagtcaattgctgaaaaaatgtgctat
gaacttagccatgacgaaaagggtagtgatgatctgaggaatcagatttatgagatggtt
gaaatccccaattgcggccatgctgtccatctggagaatcctctgcccgttatccgtgct
gtgagacagtttctgaccagagtaaatcagaattcaacttcgaatccagagtccaatgga
tag

DBGET integrated database retrieval system