KEGG   Citrus clementina (mandarin orange): CICLE_v10031326mgHelp
Entry
CICLE_v10031326mg CDS       T02982                                 

Definition
(RefSeq) hypothetical protein
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
cic  Citrus clementina (mandarin orange)
Pathway
cic00010  Glycolysis / Gluconeogenesis
cic00562  Inositol phosphate metabolism
cic01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CICLE_v10031326mg
   00562 Inositol phosphate metabolism
    CICLE_v10031326mg
Enzymes [BR:cic01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     CICLE_v10031326mg
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     CICLE_v10031326mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 18045120
NCBI-ProteinID: XP_006435803
UniProt: V4SMM6
Position
Unknown
AA seq 497 aa AA seqDB search
MKKATASFMLILCVLLLTHLNDAVQNFDVRRHLSTVSRYDFVKDVVDKNFVPSEIPDGCT
PIHLNLVARHGTRAPTKKRMRELERLADHLEVLIREAKEKGSSLQKVPGWLQGWKSPWQG
KLKGGELISKGEDELYDLGIRIREKYPDLFSEEYHPDVYPIKATQVPRASASAVAFGMGL
FNERGTLGPGRHRAFAVTSESRASDIKLRFHDCCDNYKDFRISQAPAVERLKEPILDEIT
SSIARQYELNFTRQDVSSLWFLCKQEASLLDITDQACGLFSPSEVALLEWTDDLEVFILK
GYGKSLNYRMGVPLLEDIVQSMEQAINAKEEKHTSGNYEKARLRFAHAETVIPFTCLLGL
FLERSEFQQIQKEEPLALPPKPPQSRNWRGSILAPFTGNNMLVLYSCPANSSDKYFVQVL
HNEHPTSMPGCNGTDFCPFDVFKERIVAPHLKYDYNTLCNVQTEQAIHKSKTSKLSLLLR
WLFPRWNDDTQSHKVEL
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagctacggcttcttttatgttgatcctgtgcgtacttttgttgacgcatcta
aacgacgccgttcaaaatttcgacgttcgacggcacctctcgactgtctcaagatacgac
ttcgtaaaagacgtcgttgataagaactttgtaccttctgaaattcccgatggatgtact
ccaattcacttaaatcttgtggcaaggcacgggactcgtgcacccacgaagaaacggatg
agggagttggaaagattggctgatcatttggaagtacttataagggaagccaaagaaaag
ggttcgtctttacagaaagttccgggctggttacagggatggaagtctccctggcaaggg
aaactgaagggtggtgaattgattagcaaaggagaagatgagttatatgatctcggaatc
aggattagagaaaaatatccagatttgtttagcgaggaatatcacccggatgtctatccc
attaaggctactcaggttcctcgcgcatctgcgagtgcagtagcatttggcatggggctc
tttaacgagagagggactctaggacctgggcgccatcgagcatttgctgttacaagtgaa
agccgtgcaagtgatataaagctgaggtttcatgattgttgtgacaactacaaggatttt
aggataagtcaggcccctgcagttgagaggcttaaggaaccgattcttgatgaaattacc
tcttcgatagcaaggcaatatgaactgaatttcacaagacaagatgtttcctctctttgg
ttcttatgtaaacaggaagcatccttgttggatataactgatcaagcttgtggcctcttc
agtccttctgaggttgctttgctggagtggacagatgacttagaggtgtttatattgaag
ggttatggtaaatcattaaattatcgaatgggagttcctctgcttgaggacattgttcaa
tcaatggaacaagctattaatgctaaagaagagaaacatacttctggaaattatgaaaag
gcgagacttcggtttgcacatgcagaaactgtgattccttttacttgtttgcttggactt
ttccttgaaagatctgaattccaacaaatacaaaaggaagaacccttggcactcccgcca
aagcctccccagagtagaaattggagaggcagcattctggcaccctttactgggaataac
atgctggttctgtacagctgtcctgccaactcttccgacaagtactttgtacaagtattg
cacaatgaacatccgacttcaatgccaggttgcaatggtacagatttctgtccatttgat
gtttttaaggaaagaattgttgctccacatttaaagtatgactacaatacgctctgtaat
gttcagacggaacaagccatacataagtctaaaactagtaagttgtcactactgcttcgt
tggctgttcccacggtggaatgatgatacccaatctcacaaagtagagttgtag

DBGET integrated database retrieval system