KEGG   Citrus clementina (mandarin orange): CICLE_v10032075mgHelp
Entry
CICLE_v10032075mg CDS       T02982                                 

Definition
(RefSeq) hypothetical protein
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
cic  Citrus clementina (mandarin orange)
Pathway
cic00020  Citrate cycle (TCA cycle)
cic00640  Propanoate metabolism
cic01100  Metabolic pathways
cic01110  Biosynthesis of secondary metabolites
cic01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CICLE_v10032075mg
   00640 Propanoate metabolism
    CICLE_v10032075mg
Enzymes [BR:cic01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     CICLE_v10032075mg
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CICLE_v10032075mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 18045656
NCBI-ProteinID: XP_006437603
UniProt: V4SSN1
Position
Unknown
AA seq 331 aa AA seqDB search
MARQVSSRVVRSLYMSSEICCGQSRSFTTAPPPAPAVFVDKNTRVICQGITGKNGTFHTA
QAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASAIYVPPPFAAAAILEAM
EAELDLVVCITEGIPQHDMVRVKAALNNQSKTRLIGPNCPGIIKPGECKIGIMPGYIHKP
GRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCVTKFIADPQTEGII
LIGEIGGTAEEDAAALIKESRTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIK
TLREAGVTVVESPAKIGAAMLEVFKQRGLTK
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggctcgacaagtcagtagtagagtggtgaggtcattgtatatgtcctccgagatttgt
tgcggtcagtctcgatctttcacgacggctcctccaccagcaccagcggttttcgttgac
aaaaacacccgcgtcatctgccaaggcattaccggcaagaatggcacctttcacactgca
caggctatcgaatacggcaccaaaatggttggtggagtgacaccgaagaagggtggcact
gaacatttggggcttcccgttttcaactcagttgcagaagcaaaggctgaaaccaaggct
aatgcttctgcgatttatgttcctccacctttcgctgctgctgctattcttgaggccatg
gaagctgaattggatcttgtcgtgtgtatcactgaaggaatcccccaacacgatatggtt
cgtgtgaaggctgctctaaacaaccaatcaaaaaccaggcttatcggtcctaattgccct
ggtatcattaaacctggagagtgcaaaattggaattatgcctggctacatccacaaacct
ggtaggattggaattgtttctagatctggcacccttacatatgaagcggttttccaaaca
actgcagttggtctagggcaatccacctgtgtaggtatcggtggggatccttttaatggg
acaaactttgttgactgtgtgacaaagttcattgcagatcctcagacagaaggtatcatt
cttattggtgagatagggggtaccgcagaagaggatgctgctgctttaataaaggaaagc
aggactgaaaaacctattgttgcttttattgctggacttaccgcaccacccggccgtcgt
atgggtcatgctggagctattgtgtcaggaggaaagggaacggctcaagacaaaatcaag
actttgagggaagccggagtaactgttgtcgaatcccctgcaaagattggtgctgctatg
cttgaagtctttaaacaaagaggtctcacgaagtag

DBGET integrated database retrieval system