KEGG   Citrus clementina (mandarin orange): CICLE_v10032123mgHelp
Entry
CICLE_v10032123mg CDS       T02982                                 

Definition
(RefSeq) hypothetical protein
  KO
K03428  magnesium-protoporphyrin O-methyltransferase [EC:2.1.1.11]
Organism
cic  Citrus clementina (mandarin orange)
Pathway
cic00860  Porphyrin and chlorophyll metabolism
cic01100  Metabolic pathways
cic01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cic00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CICLE_v10032123mg
Enzymes [BR:cic01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.11  magnesium protoporphyrin IX methyltransferase
     CICLE_v10032123mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mg-por_mtran_C Methyltransf_25 Methyltransf_23 Methyltransf_12 Methyltransf_11 Methyltransf_31 MTS PrmA Ubie_methyltran CheR Methyltransf_18 CMAS Methyltransf_32 AviRa TehB
Motif
Other DBs
NCBI-GeneID: 18044345
NCBI-ProteinID: XP_006436954
UniProt: V4VCX4
Position
Unknown
AA seq 322 aa AA seqDB search
MAFTASLSSHIPFYNNSSTLSPKRGKTSKTTPLLCKPVAAIPPLSTATTNSVLDLSTIAV
ISGGSIAALAAVLSLADPERRRQLQAEEVGGGDKEVVREYFNNSGFQRWKKIYGETDDVN
RVQLDIRLGHSKTVENTMQMLNDEGSLKGITVCDAGCGTGSLAIPLAKQGAIVSASDISA
AMVAEARKKAEEELLAENGGEAPVMPKFEVKDLESLDGKYDTVVCLDVLIHYPQSKADGM
IAHLASLAEKRLILSFAPKTFYYDLLKRVGELFPGPSKATRAYLHAEADVERALQKVGWK
IRKRGLITTQFYFARLVEAVPA
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggcattcacagcttcactgtcttcccacattccattctacaacaactcctctacactc
tcgccgaaacgcggcaaaacaagtaaaacgacgccgcttctgtgcaaaccagtagctgca
attcccccactctcgaccgccaccaccaactccgtcctcgacctatccaccatcgccgtc
atcagcggcggatcaatcgcagcactcgccgccgtcctctccctcgccgaccccgagcgc
cggcgccagctccaggccgaggaagtcggaggcggagacaaagaggtcgtgagagagtac
ttcaacaactcggggttccagcgttggaagaagatttacggcgagaccgatgacgttaac
agagttcagcttgacattcggctaggtcactcgaagaccgttgagaatacgatgcagatg
ttgaatgacgaaggctcgctgaaaggaattacggtttgtgacgcagggtgtgggaccggc
agtctggcgattccgttggcgaaacaaggggcgattgtctcggccagcgatatttcggcc
gcaatggttgctgaagctaggaagaaggcagaagaggagctgttagcagaaaatggaggg
gaagcaccagtgatgccgaaatttgaagtgaaggatctagagagtttagatgggaagtac
gacacagtagtctgcttagatgttttgatacattacccacaaagtaaggcagatgggatg
attgctcaccttgcttcattggctgaaaagcgacttattcttagctttgcgccaaagaca
ttttattatgatttgttaaagagggtgggcgagttgtttcctgggccttcaaaggcaacg
agggcttatctccacgccgaagctgatgtggagagggcgctacagaaggttggctggaaa
ataagaaagagaggcttaatcaccactcaattctactttgcaagacttgttgaggctgtc
cctgcatag

DBGET integrated database retrieval system