KEGG   Citrus x clementina (clementine): CICLE_v10032980mg
Entry
CICLE_v10032980mg CDS       T02982                                 
Name
(RefSeq) hypothetical protein
  KO
K02893  large subunit ribosomal protein L23Ae
Organism
cic  Citrus x clementina (clementine)
Pathway
cic03010  Ribosome
Brite
KEGG Orthology (KO) [BR:cic00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CICLE_v10032980mg
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cic03011]
    CICLE_v10032980mg
Ribosome [BR:cic03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    CICLE_v10032980mg
SSDB
Motif
Pfam: Ribosomal_L23eN Ribosomal_L23
Other DBs
NCBI-GeneID: 18045517
NCBI-ProteinID: XP_006436065
UniProt: V4TCL3
Position
Unknown
AA seq 153 aa
MAPKVDSSKKGDPKAQATKVAKAVKSGPTFKKKAKKMRTSVTFHRPKTLKKDRNPKYPRI
SAPPRNKLDHYQILKYPLTTESAMKKIEDNNTLVFIVDIRADKRKIKDAVKKMYEIQTKK
VNTLIRPDGTKKAYVRLTPDYDALDVANKIGII
NT seq 462 nt   +upstreamnt  +downstreamnt
atggctcccaaagttgacagctcaaaaaagggtgatccaaaggcccaggctactaaggtt
gccaaggctgtgaaatcagggccgacttttaagaagaaggcgaagaagatgcggacctca
gtcacattccacaggccaaagacactgaagaaggacagaaaccccaagtatccccgcatt
agtgctccaccgaggaacaagttggaccactaccaaattctcaagtatcccttgactacc
gagtcagctatgaagaagatcgaggacaataataccttggttttcattgttgacatccgt
gctgataagaggaagatcaaggatgccgtcaagaaaatgtacgaaattcagaccaagaaa
gtcaacactttgatcagacctgatggaactaagaaggcatatgttaggctgactccggat
tatgatgcattggatgtggccaacaagattggaattatctaa

DBGET integrated database retrieval system