KEGG   Celeribacter indicus: P73_0331Help
Entry
P73_0331          CDS       T03575                                 

Definition
(GenBank) maleylacetoacetate isomerase MaiA
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
cid  Celeribacter indicus
Pathway
cid00350  Tyrosine metabolism
cid00643  Styrene degradation
cid01100  Metabolic pathways
cid01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cid00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    P73_0331
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    P73_0331
Enzymes [BR:cid01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     P73_0331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N
Motif
Other DBs
NCBI-ProteinID: AJE45046
UniProt: A0A0B5DWD6
Position
337547..338185
Genome map
AA seq 212 aa AA seqDB search
MAGMMRLHHFAHSSASYRVRIALALKGLAVDYVTVDMLAREQQGADYAALNPQRLVPCLE
LEDGRVIAQSLAIIAYLETLRPAPALWPDDPVEKAQVEAQCLMIAADTSPVQARIVQRYL
EEDCGLPDAAIHGWLTHWIRRGLAPVEDFVRKSPHEFAAADTPGMLDLMIVPQLRNAERF
GIDVSDFTALAGLAGRCLRLPAFQAAHPDNWS
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggccggcatgatgcggcttcaccatttcgctcattcgagcgccagctatcgcgtcagg
atcgcgttggcgctcaaggggctggcggtcgactatgtgacggtggacatgctggcccgc
gaacagcagggcgcggactacgccgcgctcaacccgcagcgcctggttccctgcctcgag
ctcgaagacggtcgggtcatcgcgcagtcgctggccatcatcgcctatctcgaaacgctg
cgccccgcgccggcgctctggccggatgatccggtcgagaaggcgcaggtcgaggcgcaa
tgcctgatgatcgccgcggacacctcgccggtccaggcacgcatcgtccagagatatctc
gaggaggactgtgggttgcccgacgccgccatccacggctggctgacccactggatccgc
cgaggcctcgcgccggtggaggatttcgtccggaaatcaccgcatgaattcgccgccgcc
gacacccccggcatgctggacctgatgatcgtcccgcagttgcggaatgcggagcggttc
gggatcgatgtgtcggacttcacggcgctggcggggctggctggacgatgcctgcggctg
cccgcctttcaggccgcccatccggacaactggagctga

DBGET integrated database retrieval system