KEGG   Celeribacter indicus: P73_0348
Entry
P73_0348          CDS       T03575                                 

Definition
(GenBank) phenylpropionate dioxygenase ferredoxin subunit
  KO
K18087  biphenyl 2,3-dioxygenase ferredoxin component
Organism
cid  Celeribacter indicus
Pathway
cid00621  Dioxin degradation
cid01100  Metabolic pathways
cid01120  Microbial metabolism in diverse environments
cid01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cid00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    P73_0348
SSDB
Motif
Pfam: Rieske Rieske_2
Other DBs
NCBI-ProteinID: AJE45063
UniProt: A0A0B5DN79
Position
355707..356012
AA seq 101 aa
MAWIKAFPLADLPEGDMKVFDGGPEPILVCNVDGEIHAVQDTCTHDTWSLADGFLEGCII
ECSLHFAKFDVRTGKVKALPACQALKVYPAKCEGGDIYVDC
NT seq 306 nt   +upstreamnt  +downstreamnt
atggcatggatcaaggcattccctctggcagatctgcccgagggagacatgaaggtgttc
gacggcggaccggagccgatcctggtctgcaacgtggacggggaaattcatgccgtgcag
gatacctgcacgcatgacacctggtctctggcggacggcttcctcgaaggatgcatcatc
gaatgcagccttcatttcgcgaaattcgacgtgaggaccgggaaggtgaaggctctcccc
gcctgtcaggcgctcaaggtctatccggcgaaatgcgaaggcggcgacatctacgtcgac
tgctga

DBGET integrated database retrieval system