KEGG   Celeribacter indicus: P73_0351
Entry
P73_0351          CDS       T03575                                 

Definition
(GenBank) dihydrodipicolinate synthetase
  KO
K14585  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase [EC:4.1.2.45]
Organism
cid  Celeribacter indicus
Pathway
cid00626  Naphthalene degradation
cid01100  Metabolic pathways
cid01120  Microbial metabolism in diverse environments
cid01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cid00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    P73_0351
Enzymes [BR:cid01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.45  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase
     P73_0351
SSDB
Motif
Pfam: DHDPS
Other DBs
NCBI-ProteinID: AJE45066
UniProt: A0A0B5DWG7
Position
358496..359521
AA seq 341 aa
MGRDTTLEVLMKRTLLTVDDVSGCWAIMPTPSKPNASDINATDTVDLEETARTAEALVAA
GVDGILTQGTLGEAATTTWEEKQAFLRTVVETVAGRVPVFGGTTSLNTRDTIRMTRAVRE
IGVDGVMLGPPMWCQPDVPTAVRFFRDVAASCPDVAICIYANPEAFKFDFPRPFWAQIAE
IPQVVSAKYMNIAALYMDLNLTGRRIRLMPLDVDYYAAARIDPQACTAFWTSGAVCGPSP
VIRLRDLVAEANRTGDWTQAKSLTDRIAFTYRTLLPNGSFKEFSVHNIGIEKARMDAAGW
MTAGPCRPPYHLAPESALAGAREAGLQWAKLASELDGGQSA
NT seq 1026 nt   +upstreamnt  +downstreamnt
atggggcgcgacacaacgctggaagtgctcatgaaaagaactttgcttaccgtggatgac
gtgtccggctgctgggcgatcatgcccacgccgtcgaagccgaatgcgtccgatatcaac
gcgacggataccgtcgatctggaggaaaccgcccgcacagcggaagctctcgtcgcggcg
ggtgtggacggtatcctgacgcagggcacgcttggcgaggccgcgacgacgacctgggag
gaaaagcaggccttcctgcgcacggtggtcgagacggtcgcaggccgggtgccggtcttc
ggcgggacgaccagcctcaacacccgcgacaccatccgcatgaccagggcggtgcgcgag
atcggcgtcgacggcgtcatgctcggaccgccgatgtggtgccagcccgatgtgccgacg
gcggtgcggttcttccgcgatgtcgccgcctcctgccctgacgtggccatctgcatctac
gccaatccggaagcgttcaagttcgatttcccgcggccgttctgggcgcagatcgcggaa
attccccaggtcgtttctgcgaaatacatgaacatcgcggcgctttacatggacctgaac
ctgaccgggcgcaggatccgccttatgccgctcgatgtggattattacgccgccgcgcgg
atcgacccgcaggcctgcacggccttctggaccagcggcgcggtctgtggcccttcgccg
gtgatccggttgcgcgatctcgtggcggaggcgaacaggaccggcgactggacgcaggcg
aaatccctcaccgaccggatcgcgttcacctatcgcacgcttcttccgaacgggtcgttc
aaggaattctccgtccacaatatcggtatcgagaaagcgcggatggatgcggcgggctgg
atgaccgccggaccctgccgcccgccctatcacctcgcgcccgagtcggcgctcgccgga
gcgcgcgaggcgggtctccagtgggcgaagctcgcatccgaactcgatggcgggcaatcg
gcatga

DBGET integrated database retrieval system