KEGG   Celeribacter indicus: P73_0369Help
Entry
P73_0369          CDS       T03575                                 

Definition
(GenBank) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
cid  Celeribacter indicus
Pathway
cid00130  Ubiquinone and other terpenoid-quinone biosynthesis
cid00627  Aminobenzoate degradation
cid01100  Metabolic pathways
cid01110  Biosynthesis of secondary metabolites
cid01120  Microbial metabolism in diverse environments
cid01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cid00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    P73_0369
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    P73_0369
Enzymes [BR:cid01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     P73_0369
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: AJE45084
UniProt: A0A0B5DPJ1
Position
376108..376674
Genome map
AA seq 188 aa AA seqDB search
MTAPRVVLGVAGASGAALALAVARGLRVRGVETDLVVSRAAERTLAAELGPDALAGLRAL
ATRSHSVGDVGASIASGSVPVAGMIVAPCSMRSLAAIAHGFDDSLLTRAAGVQLKERRPL
VLIAREAPLTAAHLRNMLAVTELGGIVFPPVPAFYLGLPSLEAAVEQIAARAIDLLRLGP
AQARQWDG
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgccgcgcgtggtcctgggcgtggcgggcgcctcgggggcggcgctggcgctg
gccgtggcacgcggactgcgggtgcggggggtggagacggatctggtggtgagccgcgcg
gccgaacgcacgcttgccgcggaactcggccccgatgcgctcgccggcttgcgcgcgctc
gcgacccgaagccattcggtcggggatgtcggtgcgtcgatcgcctcgggctcggtgccg
gttgcgggcatgatcgtcgcgccctgttcgatgcgctcgctcgccgcgattgcgcatggc
ttcgacgacagcttgctgacccgcgccgctggcgtgcagctgaaggaacgccgcccgctg
gtgctgatcgcgcgcgaggcgccgctcacggccgcgcatctgcgcaacatgctggcggtg
acggaactgggcggaattgtgttccctccggtgccggccttctacctcggcctcccgagc
cttgaggcggcggtcgaacagatcgctgcccgcgccatagaccttctgcgtctcggcccg
gcgcaggcacggcaatgggacggctga

DBGET integrated database retrieval system