KEGG   Celeribacter indicus: P73_0439Help
Entry
P73_0439          CDS       T03575                                 

Gene name
truB
Definition
(GenBank) tRNA pseudouridine synthase B
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
cid  Celeribacter indicus
Brite
KEGG Orthology (KO) [BR:cid00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cid03016]
    P73_0439 (truB)
Enzymes [BR:cid01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     P73_0439 (truB)
Transfer RNA biogenesis [BR:cid03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    P73_0439 (truB)
 Prokaryotic type
    P73_0439 (truB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TruB_N TruB_C_2
Motif
Other DBs
NCBI-ProteinID: AJE45154
UniProt: A0A0B5DPW0
Position
complement(443386..444294)
Genome map
AA seq 302 aa AA seqDB search
MARRKKGRAVHGWLIVDKPAGMTSTAVVNKVRWALDAQKAGHAGTLDPDATGVLAVALGE
ATKTVPFITEALKCYRFSVRFGQATNTDDAEGEVIAESDARPSDEEISDALPRFEGDILQ
VPPKFSAVKIDGERAYKRAREEEEFEIAARPLYVEALTFLERPDPDHAILEMTCGKGGYV
RAVARDLGETLGCHAHVEWLRREWSGPWEAGEGISIAEVDEMARTEALDAFLRPVEEGLA
DLDEVLCTPESATRLRNGNPGMVYPAEGIEYGDEVWASFEGRPVAVGIYRGGELHPSRVF
NL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggcccgccgcaagaaaggccgcgcagttcacggttggctgatcgtggacaagcccgcc
ggcatgacctccaccgccgtcgtcaacaaggtgcgctgggcgctcgatgcgcaaaaggcc
ggtcatgccggcacgctcgatcccgatgcgaccggcgtcctggccgtggcgctgggcgag
gcgacgaagaccgtgcctttcatcaccgaagcactcaaatgctaccgtttctcggtccgt
ttcggacaggcgacgaacaccgacgatgccgagggcgaggtgatcgcggagagcgatgcg
cgccccagcgacgaggagatctccgacgcgctgccgcgtttcgagggtgacatcctccag
gtgccgccgaaattctccgccgtgaagatcgacggcgaacgcgcctacaagcgcgcacgc
gaagaggaggagttcgagatcgccgcccgtccgctctatgtcgaggcattgacattcctc
gaacggccggatcccgatcacgcgatcctggaaatgacctgtggcaagggcggatatgtc
cgcgccgtggcccgtgaccttggcgagacactcgggtgccacgcccatgtggaatggctg
cgccgcgaatggtcggggccgtgggaggccggagagggcatttccatcgcggaggtggac
gagatggcccgcaccgaagcgctcgacgctttcctgcgcccggtcgaagaggggcttgcc
gatctcgacgaagttctgtgcacccctgagagtgcaacacggctcaggaacggcaatccc
ggcatggtctatcccgccgaaggcatcgaatacggcgacgaggtctgggcctcgttcgag
ggacgccccgtggcggtcggcatctacaggggcggcgaactgcacccgagccgtgtcttc
aacctctga

DBGET integrated database retrieval system