KEGG   Celeribacter indicus: P73_1382Help
Entry
P73_1382          CDS       T03575                                 

Definition
(GenBank) 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase
  KO
K18365  4-hydroxy-2-oxovalerate/4-hydroxy-2-oxohexanoate aldolase [EC:4.1.3.39 4.1.3.43]
Organism
cid  Celeribacter indicus
Pathway
cid00362  Benzoate degradation
cid00621  Dioxin degradation
cid00622  Xylene degradation
cid01100  Metabolic pathways
cid01120  Microbial metabolism in diverse environments
cid01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cid00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    P73_1382
   00622 Xylene degradation
    P73_1382
   00621 Dioxin degradation
    P73_1382
Enzymes [BR:cid01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     P73_1382
    4.1.3.43  4-hydroxy-2-oxohexanoate aldolase
     P73_1382
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm ThiG
Motif
Other DBs
NCBI-ProteinID: AJE46097
UniProt: A0A0B5E0V8
Position
1382247..1383272
Genome map
AA seq 341 aa AA seqDB search
MSIEGRNVTLHEMSLRDGMHAKRQQISIEEMITIAKALDAAGMPWIEVTHGDGLGGNSVN
YGFAPATDDEYLAAVIPHIKNAKVSALLLPGIGILDDLKRAMDLGISGVRIATHCTEADV
AEQHIKFAAQTDLDTVGFLMMSHRNSPEGLVEEALKMESYGANCIYCTDSAGYMLPDDVR
ARITALREALSPETELGFHGHHNLGMGIANSVAAVECGANRIDGAAAGLGAGAGNAPMEL
LVAVFNRMSVQTGVDLFGIMDVAEDLVVPMMDHFVRVDRNSLTIGYAGVYSSFLLFAKRA
EERYGIPARELLMELGKRGMVGGQEDMIEDLALTWRRERRT
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcgaaggccgcaacgtcacattgcacgaaatgagcctgcgcgatggcatgcat
gccaagcgccagcaaatctccatcgaggagatgatcaccatcgccaaggcgctcgacgcc
gcagggatgccctggatcgaagtgacccatggggatggtctgggcggcaactccgtcaac
tacggtttcgccccggccacggacgatgaatatctcgccgccgtgatcccgcatattaag
aacgcgaaagtctctgcgctgctgcttcccggcatcggcattctggacgatctcaaacgt
gcaatggatctcgggatttccggtgttcggatcgccacgcattgcaccgaggcggatgtc
gccgaacagcatatcaaatttgccgcccagaccgatctcgatacggtcggtttcctgatg
atgtcgcatcgcaacagccccgaagggttggtggaagaagcgctgaagatggaaagctat
ggcgccaactgcatctattgcaccgactccgcaggttatatgctacccgacgacgtaaga
gcgcggatcactgcgctgcgcgaggcgctgtcgccggagacggaactcggattccatggt
caccataacttgggtatggggattgccaattccgtcgctgccgttgaatgcggggccaac
cgcatcgatggggctgccgccggtctcggtgccggtgcgggcaatgcgccgatggagctg
ctcgttgcggttttcaaccgtatgagcgtgcagaccggggtcgacctgttcggtattatg
gatgtcgccgaagatcttgtcgtgccgatgatggaccattttgtccgggtggaccgcaac
tctctgaccattggttacgcaggtgtctacagctccttcctgctcttcgcgaagcgggcg
gaggaacgctacggcatcccggcgcgcgaattgcttatggaattgggcaagcgaggtatg
gtcggtggtcaggaggatatgatcgaagatctcgcactgacctggcggcgcgagcgtcgt
acgtaa

DBGET integrated database retrieval system