KEGG   Celeribacter indicus: P73_3480Help
Entry
P73_3480          CDS       T03575                                 

Gene name
glyQ
Definition
(GenBank) glycyl-tRNA ligase subunit alpha
  KO
K01878  glycyl-tRNA synthetase alpha chain [EC:6.1.1.14]
Organism
cid  Celeribacter indicus
Pathway
cid00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:cid00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    P73_3480 (glyQ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cid01007]
    P73_3480 (glyQ)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cid03016]
    P73_3480 (glyQ)
Enzymes [BR:cid01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     P73_3480 (glyQ)
Amino acid related enzymes [BR:cid01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   P73_3480 (glyQ)
Transfer RNA biogenesis [BR:cid03016]
 Prokaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    P73_3480 (glyQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2e N-glycanase_C
Motif
Other DBs
NCBI-ProteinID: AJE48195
UniProt: A0A0B5E4B5
Position
complement(3555951..3556892)
Genome map
AA seq 313 aa AA seqDB search
MSETPVKPRSFQEIILRLQAYWAAKGCAILQPYDMEVGAGTFHPATTLRSLGSTPWAAAY
VQPSRRPTDGRYGENPNRLQHYYQYQVLIKPSPPDLQDLYLGSLEAIGIDTELHDIRFVE
DDWESPTLGAWGLGWEVWCDGMEVSQFTYFQQVGGHDCHPVSGELTYGLERLAMYVLGID
HVMDMPFNDPQAPIALSYGDIFRQTEEEYSRHNFDVANTEVLLRHFEEAEAECHALLDQP
AEDPKTGKRIVMAHPAYDQCIKASHIFNLLDARGVISVTERQAYIGRVRALAKACADAFV
QTEAGGYVVGAAG
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagacgcccgtgaaaccgcgctccttccaggagatcatcctgcgccttcaggcc
tattgggccgcgaagggctgcgcgatcctccagccctacgacatggaggtgggcgccggt
accttccacccggccacgacgctgcgctctcttggctcgacgccctgggcggcggcctat
gtgcagccctcgcgccgccccaccgacgggcgctatggcgagaatccgaaccgcttgcag
cattattaccagtaccaggtgctgatcaaaccctcgccgccggacctccaggatctctat
ctcggctcgctcgaggccatcggcatcgacacggagctgcacgacatccgcttcgtcgag
gacgactgggaaagcccgacgctcggcgcctgggggctgggctgggaagtctggtgcgac
gggatggaagtcagccagttcacctatttccagcaggtcggcggccatgactgccacccc
gtgtccggggaactgacctatgggctcgaacggctcgcgatgtatgtgctcggcattgat
catgtgatggacatgcccttcaacgacccgcaggcgccgatcgcactctcctatggcgac
atcttccgccagacggaggaggaatattcgcgccacaatttcgacgtggccaataccgag
gtactgctccggcatttcgaggaggcggaggcggaatgccacgcgctgctcgaccagccg
gcggaggatcccaagaccggaaagcggatcgtcatggcccatcccgcctatgaccagtgc
atcaaggccagccatatcttcaacctgctcgacgcgcgcggcgtgatctcggtcaccgaa
cgccaggcctatatcggccgggtgcgcgcgctggcgaaagcctgtgccgatgccttcgtg
cagaccgaggcgggcggatacgtggtcggggcggccgggtaa

DBGET integrated database retrieval system