KEGG   Celeribacter indicus: P73_3553Help
Entry
P73_3553          CDS       T03575                                 

Definition
(GenBank) methionyl-tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cid  Celeribacter indicus
Pathway
cid00450  Selenocompound metabolism
cid00970  Aminoacyl-tRNA biosynthesis
cid01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cid00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    P73_3553
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    P73_3553
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cid01007]
    P73_3553
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cid03016]
    P73_3553
Enzymes [BR:cid01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     P73_3553
Amino acid related enzymes [BR:cid01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   P73_3553
Transfer RNA biogenesis [BR:cid03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    P73_3553
 Prokaryotic type
   Other AARSs
    P73_3553
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1
Motif
Other DBs
NCBI-ProteinID: AJE48268
UniProt: A0A0B5DXV4
Position
3624690..3626408
Genome map
AA seq 572 aa AA seqDB search
MARTLITSALPYINGIKHLGNLVGSQLPADLYARYRRARGDEVLFLCATDEHGTPAEIAA
QKAGKPVAEYCAEMHKVQAEIAAGFRLSFDHFGRSSSPQNHRLTQHFARRLGEEGLIEAV
EETQIYSETDGRFLPDRYIEGTCPNCGYDGARGDQCDNCTKQLDPTDLINPHSTISGATD
LEERVTKHLYLRQSKMRDALNDWIETKIDWPVLTTSIAKKWLHDGDGLQDRGITRDLSWG
VPVQFEGAPWEGMDGKVFYVWFDAPVEYIACGAEWAAKQGLGEEDWERWWRTDKGADDVR
YVEFMGKDNVPFHTLSFPVTLLGSGEPWKMVDYIKSFNYLNYDGGQFSTSRGRGVFMDQA
LSILPADYWRWWLLSHAPENSDAEFTWENFQASVNKDLADVLGNFVSRITKFCRSKFSEA
VPEGGAHGEQETALIADLTEKVREYQSHMDAIEVRKGAAALRAIWVAGNEYMQSAAPWAT
FKEDPEKAAAQVRLGLNLIALYARLSAPFLPDTAGKLQTALGLDSLDWPEDVATALEALA
PGREFVVPDNLFTKITDEQREDWQNRFAGRRA
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcacgctcatcacctcggccctgccctatatcaacggcatcaagcatctcggc
aatctggtcggttcccagcttccggccgatctctatgcgcgctaccgccgggcgcggggc
gacgaggtgctgttcctctgcgccaccgacgaacacggcacgcccgccgagatcgccgcg
cagaaggccggcaagcccgtcgcggaatattgcgccgagatgcacaaggtccaggcggag
atcgccgcgggcttccgcctctccttcgaccatttcggccgctcctcctcgccgcagaac
caccggctgacccagcatttcgcccggcgcctcggcgaggaagggctgatcgaggcggtg
gaggagacccagatctattccgagacggacggccgcttcctgcccgaccgctatatcgag
ggcacctgcccgaattgcggctatgacggcgcccgcggcgaccagtgcgacaattgcacg
aaacagctcgacccgaccgacctcatcaacccgcattcgacgatctccggcgcgacggat
ctcgaggaacgggtcacgaaacacctctatctccggcagtcgaagatgcgcgacgcgctc
aacgactggatcgagaccaagatcgactggccggtgctcaccacctccatcgcgaagaaa
tggctccacgacggcgacggcctccaggatcgcggcatcacgcgcgacctgtcctggggg
gtgccggtgcaattcgagggcgcgccctgggaaggcatggacggcaaggtgttctacgtc
tggttcgacgcccctgtggaatacatcgcctgcggcgcggaatgggcggcgaaacaaggg
cttggggaagaggactgggagcgctggtggcggaccgacaagggcgccgacgatgttcga
tatgtggaattcatgggcaaggacaacgtgcccttccacaccctctccttcccggtcacc
ctgctgggctccggcgagccgtggaagatggtcgactacatcaaatccttcaactacctc
aactacgacggcggacaattctccacctcgcgcgggcgcggcgtgttcatggaccaggcc
ctctccatcctgcccgcggattactggcgctggtggctgctctcccacgcgccggaaaat
tccgatgccgaattcacctgggaaaacttccaggcctcggtgaacaaggaccttgccgac
gtgctcgggaatttcgtctcccgcatcaccaaattctgccgctcgaaattctccgaggcg
gtgccggagggcggcgcccatggcgagcaggagacggcgctgattgccgatctgacggaa
aaggtcagggaatatcaatcgcatatggatgcgatcgaggtccgcaagggtgccgcggcg
ctgcgcgcgatctgggtggccggcaacgaatacatgcagtcggccgcaccctgggcgacg
ttcaaggaagacccggaaaaggccgcggcacaggtccggctcgggctcaatctcatcgcg
ctctacgcccgcctctccgcgcccttcctccccgacacggcaggaaagctccagaccgcc
ctcggcctcgacagcctcgactggccggaggatgtcgccaccgcgctcgaagccctggcg
ccggggcgggaattcgtcgtgcccgacaacctcttcaccaagatcacagacgagcagcgc
gaggactggcagaaccgcttcgccggccggcgcgcctga

DBGET integrated database retrieval system