KEGG   Celeribacter indicus: P73_4255Help
Entry
P73_4255          CDS       T03575                                 

Definition
(GenBank) acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cid  Celeribacter indicus
Pathway
cid00071  Fatty acid degradation
cid00072  Synthesis and degradation of ketone bodies
cid00280  Valine, leucine and isoleucine degradation
cid00310  Lysine degradation
cid00362  Benzoate degradation
cid00380  Tryptophan metabolism
cid00620  Pyruvate metabolism
cid00630  Glyoxylate and dicarboxylate metabolism
cid00640  Propanoate metabolism
cid00650  Butanoate metabolism
cid00900  Terpenoid backbone biosynthesis
cid01100  Metabolic pathways
cid01110  Biosynthesis of secondary metabolites
cid01120  Microbial metabolism in diverse environments
cid01130  Biosynthesis of antibiotics
cid01200  Carbon metabolism
cid01212  Fatty acid metabolism
cid02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cid00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    P73_4255
   00630 Glyoxylate and dicarboxylate metabolism
    P73_4255
   00640 Propanoate metabolism
    P73_4255
   00650 Butanoate metabolism
    P73_4255
  09103 Lipid metabolism
   00071 Fatty acid degradation
    P73_4255
   00072 Synthesis and degradation of ketone bodies
    P73_4255
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    P73_4255
   00310 Lysine degradation
    P73_4255
   00380 Tryptophan metabolism
    P73_4255
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    P73_4255
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    P73_4255
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    P73_4255
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cid04147]
    P73_4255
Enzymes [BR:cid01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     P73_4255
Exosome [BR:cid04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   P73_4255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AJE48970
UniProt: A0A0B5E6B6
Position
4397459..4398634
Genome map
AA seq 391 aa AA seqDB search
MTNVVIASAARTAVGSFLGSFANTPAHDLGAAVLEALVERAGIEKGEVSETILGQVLTAG
QGQNPARQAHINAGLPKESAAWGINQVCGSGLRAVALGAQHILLGDAEIICAGGQESMSM
SPHLANLRQGHKMGDLKFIDSMIKDGLWDAFNGYHMGNTAENVAAQWQISREQQDEFALA
SQNKAEAAQEAGRFRDEIIPFTVKTRKGETVVEDDEYIRKGATIEAMQKLRPAFDKEGTV
TAGNASGINDGAAGVLLMSAENAEKRGIRPLARIASYATAGLDPAIMGVGPIHASRKALE
KAGWKPQDLDLVEANEAFAAQACAVNKDMGWDPAIVNVNGGAIAIGHPIGASGARVLNTL
LFEMQRRDAKKGLATLCIGGGMGVALCVERD
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaccaatgtcgtcatcgcatccgcagcgcggaccgccgtcgggagctttctgggctcc
tttgccaacacgcccgcccatgacctcggcgcggccgtcctcgaggcgctggtggagcgc
gccggcatcgagaagggcgaggtgtccgagacgatcctcggtcaggtgctgactgccgga
caagggcagaatcccgcccgccaggcgcatatcaacgccggactgccgaaggaatcggcc
gcctggggcatcaaccaagtctgcggctcgggcctgcgcgccgtcgcgctcggagcgcag
cacatcctgctcggcgatgcggagatcatatgcgccggcggccaggagagcatgtcgatg
tcgccccatctcgccaatctccgccaggggcacaagatgggcgatctgaagttcatcgat
tcgatgatcaaggacgggctgtgggacgcgttcaacggataccacatgggcaacaccgcc
gaaaatgtcgccgcgcaatggcagatctcgcgcgagcagcaggacgagttcgccctcgcc
tcccagaacaaggcggaagctgcccaggaggccggcaggttcagggacgagatcatcccc
ttcaccgtaaagacccgtaagggcgaaaccgtcgtcgaagatgacgaatacatccgcaag
ggtgctacgatcgaggcgatgcagaaactccgccccgccttcgacaaggagggcacggtc
accgcgggcaatgcctccggcatcaacgacggcgcagccggcgtactgctgatgtccgcg
gagaacgcggaaaaacgtggcatccggccgctcgcgcgcatcgcctcctacgccacggcc
ggcctcgacccggcgatcatgggcgtcggaccgatccacgcctctcgcaaggcgctcgaa
aaggcgggctggaagccccaggatctcgatctcgtggaggccaacgaagccttcgcggcg
caggcctgcgcggtgaacaaggacatgggatgggatcccgcgatcgtcaacgtgaacggc
ggcgcgatcgctatcggacatcccatcggcgcctcgggcgcgcgggtactgaacacactg
ctcttcgagatgcagcgacgcgacgctaagaagggtctcgccacgctctgcatcggcggc
ggcatgggcgttgccctctgcgtcgagcgcgactga

DBGET integrated database retrieval system