KEGG   Citrobacter sp. CRE-46: AN232_05210Help
Entry
AN232_05210       CDS       T05520                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
cie  Citrobacter sp. CRE-46
Pathway
cie00051  Fructose and mannose metabolism
cie01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cie00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    AN232_05210
Enzymes [BR:cie01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     AN232_05210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh 3HCDH_N AfaD
Motif
Other DBs
NCBI-ProteinID: AWS94668
UniProt: A0A2Z3X0Z3
Position
complement(1036415..1037563)
Genome map
AA seq 382 aa AA seqDB search
MKALHFGAGNIGRGFIGKLLADAGIQLTFADVNQVVLDALNARHSYQVHVVGENEQVDTV
SGVNAVSSIGDDVVDLIAHVDLITTAVGPVVLERIAPAIAKGLVKRKAQGISTPLNIIAC
ENMVRGTTQLKGHVMNALADEDKAWVEEHVGFVDSAVDRIVPPSASATNDPLEVTVETFS
EWIVDQTQFKGELPNIPGMELTDNLMAFVERKLFTLNTGHAITAYLGKLTGHQTIRDAIL
DEKIRAVVKGAMEESGAVLIKRYGFDADKHAAYIQKILGRFENPYLKDDVERVGRQPLRK
LSAGDRLIKPLLGTLEYGLPHVNLVTGIAAAMHYRSEEDPQAQELAALIDEKGPQAALAQ
VSGLDANSDVVAEAVHAYNATK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattacattttggcgcaggtaatatcggtcgtggctttatcggcaaactgctg
gcggacgcggggatacagctgacgtttgcagatgtaaaccaggtcgtgctcgatgccctg
aatgcccgtcatagctatcaggttcatgttgtgggtgaaaacgagcaggttgataccgtt
tccggcgtcaacgccgtcagcagcatcggcgatgatgtcgtcgatctaattgcccacgtt
gatttaatcactactgccgtaggtccggttgtgcttgagcgtatcgctccggccatcgct
aaagggctggtaaaacgcaaagcgcagggcatctctaccccgctgaatatcatcgcctgt
gaaaacatggtgcgcggaaccacgcagttgaaaggccacgtcatgaacgcgctggcagat
gaagacaaagcctgggttgaagaacatgttggctttgtcgattccgccgtggatcgcatc
gtgccgccatctgcttctgcgaccaacgatccgctggaagttaccgtcgaaacattcagc
gagtggattgtcgaccaaacgcagttcaaaggcgagctgccaaacatcccgggaatggaa
ttaactgataacctgatggcatttgtcgaacgtaaactcttcacgctgaacaccgggcat
gctataaccgcgtacctcggcaaattgaccggtcatcagaccatccgtgacgcgattctc
gacgagaaaatccgcgcagtggtaaaaggtgcaatggaagagagcggcgcggtactgatc
aaacgctacggttttgatgccgataaacacgcggcttatatccagaagatcctcggtcgt
tttgaaaacccgtatctgaaagatgatgttgagcgcgttggacgtcagccgctgcgtaaa
ctgagtgcaggcgaccgtctgattaaaccgctgctgggcacgctggagtatggtctaccg
cacgttaatctggttaccggtattgctgctgcaatgcattaccgcagtgaagaagatccg
caggcacaggaactggccgcgctgattgacgaaaaaggtccacaggccgcgctggcgcag
gtatccggtctggatgccaacagtgatgtggtggcggaggcggttcacgcatataacgcg
accaaatga

DBGET integrated database retrieval system