KEGG   Citrobacter sp. FDAARGOS_156: AL515_02795Help
Entry
AL515_02795       CDS       T04313                                 

Definition
(GenBank) PTS fructose transporter subunit IIB
  KO
K02813  PTS system, sorbose-specific IIB component [EC:2.7.1.206]
Organism
cif  Citrobacter sp. FDAARGOS_156
Pathway
cif00051  Fructose and mannose metabolism
cif01100  Metabolic pathways
cif02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:cif00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    AL515_02795
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    AL515_02795
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cif02000]
    AL515_02795
Enzymes [BR:cif01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.206  protein-Npi-phosphohistidine---L-sorbose phosphotransferase
     AL515_02795
Transporters [BR:cif02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Sorbose-specific II component
    AL515_02795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTSIIB_sorb
Motif
Other DBs
NCBI-ProteinID: AMH12835
Position
complement(599445..599939)
Genome map
AA seq 164 aa AA seqDB search
MNITLARIDDRLIHGQVTTVWSKVANAQRIIICNDDVYNDEVRRTLLRQAAPPGMKVNVV
NIEKAVAVYHNPQYQNETVFYLFTRPQDALAMVKQGVKITTLNIGGMAWRPGKKQLTKAV
SLDNDDIHAFRELDKLGVTLDLRVVASDPSINILEKIEEQSFAE
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaacattacccttgctcgtattgatgaccgcctgatccacggtcaggtcaccaccgtc
tggtcgaaggtggcgaatgcacaacggattattatctgtaatgacgacgtttataacgat
gaagtacgtcgcacattattgcgtcaggccgccccgccgggaatgaaagtgaacgtcgtt
aatatcgaaaaggcggtcgcggtttaccataatccgcaataccagaacgaaaccgttttt
tatctatttacccgcccgcaggatgcattagcaatggtaaaacaaggggtaaaaatcacc
acattaaatattggcggcatggcctggcgaccaggtaaaaaacaattaaccaaagccgtt
tctttagataacgacgatattcatgcgtttcgtgagttagataaactgggtgtcacgctg
gatttacgcgtcgtcgcatccgatccatctattaatattctcgaaaaaatagaagaacaa
tcgttcgctgaataa

DBGET integrated database retrieval system