KEGG   Citrobacter sp. FDAARGOS_156: AL515_04680Help
Entry
AL515_04680       CDS       T04313                                 

Definition
(GenBank) dUMP phosphatase
  KO
K08723  5'-nucleotidase [EC:3.1.3.5]
Organism
cif  Citrobacter sp. FDAARGOS_156
Pathway
cif00230  Purine metabolism
cif00240  Pyrimidine metabolism
cif00760  Nicotinate and nicotinamide metabolism
cif01100  Metabolic pathways
cif01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cif00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AL515_04680
   00240 Pyrimidine metabolism
    AL515_04680
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    AL515_04680
Enzymes [BR:cif01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     AL515_04680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD MMADHC
Motif
Other DBs
NCBI-ProteinID: AMH13179
Position
992753..993433
Genome map
AA seq 226 aa AA seqDB search
MKKWDWIFFDADETLFTFDSFTGLQRMFLDYSITFTAEDFQDYQAVNKPLWVDYQNGAIT
SLQLQHARFQSWAERLKVEPGQLNDAFINAMAEICSPLPGAVSLLNAIRDKTKIGIITNG
FTALQQIRLERTGLRDYFDLLVISEQVGVAKPDPRIFDHALEQAGNPDRSRVLMVGDTAE
SDILGGINAGLSTCWLNTHHREQPAGIQPTWTVTSLSELEQLLCKH
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagtgggactggattttctttgatgccgacgaaacgctgtttacatttgactcg
tttaccggcttacagcggatgtttctcgactatagcattacctttaccgctgaagatttt
caggactaccaggccgtgaataaaccgctgtgggtggattatcaaaacggtgcaattacc
tcattacagttgcagcatgcccgttttcagagctgggccgaacgcctgaaggttgaaccg
ggccagcttaatgatgcattcatcaatgcgatggcggagatctgctcgccgttgccgggg
gcggtttctctgctcaatgcgattcgtgataaaacaaaaattggcattattaccaacggc
ttcacggcgttacagcaaatccgccttgagcggacggggctgcgcgattatttcgatctg
ctggtgatttctgagcaggttggggtggcaaaacccgatccccgtatttttgaccatgcg
ctggagcaggcgggcaatcctgaccgttctcgcgtgctaatggtgggtgacaccgcagag
tccgatattcttggcggcattaacgccgggctctccacctgctggctaaatacgcatcac
cgcgagcagccagcaggcattcagccgacctggacggtcacgtcattaagcgaactggag
cagctcctgtgtaaacactga

DBGET integrated database retrieval system