KEGG   Citrobacter sp. FDAARGOS_156: AL515_14030Help
Entry
AL515_14030       CDS       T04313                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
cif  Citrobacter sp. FDAARGOS_156
Pathway
cif00030  Pentose phosphate pathway
cif00480  Glutathione metabolism
cif01100  Metabolic pathways
cif01110  Biosynthesis of secondary metabolites
cif01120  Microbial metabolism in diverse environments
cif01130  Biosynthesis of antibiotics
cif01200  Carbon metabolism
Module
cif_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
cif_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
cif_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:cif00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AL515_14030 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AL515_14030 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cif04147]
    AL515_14030 (zwf)
Enzymes [BR:cif01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     AL515_14030 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     AL515_14030 (zwf)
Exosome [BR:cif04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   AL515_14030 (zwf)
  Exosomal proteins of colorectal cancer cells
   AL515_14030 (zwf)
  Exosomal proteins of bladder cancer cells
   AL515_14030 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: AMH14910
Position
complement(3006703..3008178)
Genome map
AA seq 491 aa AA seqDB search
MAVTQTAQACDLVIFGAKGDLARRKLLPSLYQLEKAGQINPETRIIGVGRADWDKAAYTK
VVREALETFMKEKIDESLWETLSGRLEFCNLDVNDTAAFSRLGEMLDQKSRTTINYFAMP
PSTFGAICKGLGEAKLNAKPARVVMEKPLGTSLATSREINDQVGEYFEECQVYRIDHYLG
KETVLNLLALRFANSLFVNNWDNRTIDHVEITVAEEVGIEGRWGYFDQAGQMRDMIQNHL
LQILCMIAMSPPADLSADSIRDEKVKVLKSLRRIDRSNVREKTVRGQYTTGFAQGKKVPG
YLEEEGANKSSNTETFVAIRVDIDNWRWTGVPFYLRTGKRLPTKCSEVVVYFKTPELNLF
KESWQDLPQNKLTIRLQPDEGVDIQVLNKVPGLDHKHNLQITKLDLSYSETFNQTHLADA
YERLLLETMRGIQALFVRRDEVEEAWKWVDSITEAWAMDNESPKPYQAGTWGPVASVAMI
TRDGRSWNEFE
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggcggtaacgcaaacagcccaggcatgtgacctggtcattttcggtgcgaagggcgac
ctggcgcgacggaaattgctgccttccctgtatcaactggaaaaggccggccagattaac
ccggaaacccgtatcattggggttgggcgtgctgattgggacaaagctgcctataccaag
gttgtacgcgaagcgctcgaaactttcatgaaagaaaaaattgatgaaagtttatgggaa
actctcagtggccgtctggagttttgtaacctggacgtcaatgacaccgccgcatttagc
cgtctgggcgagatgctggatcaaaaatcacgtaccacgattaactatttcgctatgccg
ccaagcacctttggcgcgatctgcaaaggcttgggtgaagcaaagctgaatgctaaaccc
gctcgcgtggtgatggaaaaaccgctgggcacgtctctggcgacatcccgtgaaatcaac
gatcaggttggcgaatacttcgaagagtgccaggtttatcgtattgaccactatctcggg
aaagagacggtcctgaacctgttggcactgcgttttgccaactccctgtttgtgaacaac
tgggataaccgcactatcgatcacgtagaaattaccgtggctgaagaggtcggtattgaa
ggccgctggggctattttgaccaggccggtcaaatgcgcgatatgatccagaaccacttg
ctgcaaatcctctgcatgatcgcaatgtcccctccggctgatctgagcgccgacagcatt
cgcgatgagaaagtgaaggtcctgaaatcgctgcgtcgcatcgatcgctcgaacgtgcgt
gaaaaaacggttcgcggccagtacaccactggttttgcccagggtaaaaaggtaccgggt
tacctggaagaagagggcgcgaataagagcagcaatacggaaacgtttgtggcgatccgc
gtcgatatcgataactggcgttggacgggtgtaccgttctacctgcgtaccggtaaacgt
ttaccaaccaagtgctctgaagtggtggtttacttcaaaacacctgagctgaatctgttt
aaagaatcctggcaggatctgccgcagaacaagttgactattcgtttgcagcctgatgaa
ggggttgatatccaggtactgaacaaagtgccgggtctggaccacaaacataatctgcag
atcactaagctggatctgagctactcagaaaccttcaaccaaacgcacctggccgacgcc
tatgagcgcctgctgttggaaaccatgcgcggtattcaggctctgtttgtgcgtcgcgat
gaagtcgaagaagcctggaagtgggtggattcaattactgaagcctgggcgatggataac
gagtcgccgaagccttatcaggcaggaacctggggaccggttgcgtctgtggccatgatt
acccgtgacggtcgttcctggaacgaattcgagtaa

DBGET integrated database retrieval system