KEGG   Citrobacter sp. FDAARGOS_156: AL515_15975Help
Entry
AL515_15975       CDS       T04313                                 

Definition
(GenBank) histidine ABC transporter ATP-binding protein HisP
  KO
K10017  histidine transport system ATP-binding protein [EC:7.4.2.1]
Organism
cif  Citrobacter sp. FDAARGOS_156
Pathway
cif02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:cif00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AL515_15975
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cif02000]
    AL515_15975
Enzymes [BR:cif01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     AL515_15975
Transporters [BR:cif02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    AL515_15975
   Histidine transporter
    AL515_15975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 AAA_29 AAA_13 ABC_ATPase AAA_16 AAA_23 AAA_33 G-alpha PRK RsgA_GTPase FtsK_SpoIIIE AAA_24 DUF87 NACHT AAA_22
Motif
Other DBs
NCBI-ProteinID: AMH15269
Position
complement(3424262..3425035)
Genome map
AA seq 257 aa AA seqDB search
MSENKLNVIDLHKHYGEHEVLKGVSLQANAGDVISIIGSSGSGKSTFLRCINFLEKPSAG
TIVVSGQNIGLVRDKDGQLKVADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQV
LGLSKQEARERAVKYLAKVGIDERAQGKYPVHLSGGQQQRVSIARALAMEPEVLLFDEPT
SALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSTHVIFLHQGKIEEEGDPEQVF
GNPQSPRLQQFLKGSLK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaaataaattaaacgttatcgatttacataagcactacggcgaacatgaagtg
ctgaaaggggtatcgctgcaggccaatgcgggtgatgttatcagtattattggttcgtca
ggttcgggtaaaagtaccttcctgcgctgcattaactttctggaaaagccgagtgccgga
acgattgtggttagcggtcagaatattggcctggtgcgcgacaaagacggtcagttgaag
gttgcagataaaaatcagctgcgtctgctacgcacgcgactgacgatggtctttcagcac
ttcaacctgtggagtcacatgacggtgctggaaaacgtgatggaagcgccgattcaggtg
ctggggctgagcaagcaggaagcccgcgaacgtgcggtgaagtatctggctaaagtgggc
attgatgagcgcgcgcagggcaaatatccggtgcatctgtccggtggtcagcagcagcgt
gtttccattgcccgtgcgctggcgatggagccggaagtgttgctgtttgatgaacccacg
tcggcacttgatcctgagctggtgggtgaagtgctgcgtattatgcaacagctggccgaa
gagggtaaaaccatggtggtcgtgacccacgaaatgggattcgctcgacatgtctccacg
cacgtgattttcctgcatcaggggaaaattgaggaagagggcgacccggagcaggtattc
ggtaatccgcaaagcccgcgtttgcagcagtttctcaagggctcgctgaaataa

DBGET integrated database retrieval system