KEGG   Citrobacter sp. FDAARGOS_156: AL515_21700Help
Entry
AL515_21700       CDS       T04313                                 

Definition
(GenBank) DNA-binding response regulator
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
cif  Citrobacter sp. FDAARGOS_156
Pathway
cif02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cif00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AL515_21700
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:cif02022]
    AL515_21700
Two-component system [BR:cif02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   AL515_21700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C FleQ
Motif
Other DBs
NCBI-ProteinID: AMH16316
Position
complement(4611533..4612252)
Genome map
AA seq 239 aa AA seqDB search
MQENYKILVVDDDMRLRALLERYLTEQGFQVRSVANAEQMDRLLTRESFHLMVLDLMLPG
EDGLSICRRLRSQSNPMPIIMVTAKGEEVDRIVGLEIGADDYIPKPFNPRELLARIRAVL
RRQANELPGAPSQEEAVIAFGKFKLNLGTREMFREDEPMPLTSGEFAVLKALVSHPREPL
SRDKLMNLARGREYSAMERSIDVQISRLRRMVEEDPAHPRYIQTVWGLGYVFVPDGSKA
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgcaagagaactataagattctggtggtcgatgacgacatgcgcttgcgtgcgcttctg
gaacgttatttgaccgagcagggcttccaggttcgaagcgtcgcaaacgctgagcagatg
gatcgtctgctgacccgtgagtctttccacctgatggtgctcgatttaatgctgccggga
gaagatggcctgtctatttgccgtcgcctgcgcagccaaagcaacccgatgccgatcatt
atggtgacggcgaagggcgaagaagtggaccgtattgttggactggaaatcggcgctgac
gattacattccgaaaccgtttaacccgcgtgaactgctggcgcgtatccgcgctgtactg
cgtcgtcaggcaaacgaactgccgggcgcgccttcccaggaagaagcggtcattgcgttt
ggtaagttcaaactgaacctcggtacgcgtgaaatgttccgcgaagatgagcctatgccg
ctcaccagcggtgaatttgcggtgctgaaagcgttggtaagccacccacgtgaaccgctg
tcccgcgacaagttgatgaacctcgcccgtggtcgtgaatattctgcgatggaacgttct
atcgacgtccagatttcccgtctgcgtcgtatggtggaagaagacccggcgcaccctcgt
tatattcagaccgtatggggtctgggctacgtctttgttccggacggttctaaagcatga

DBGET integrated database retrieval system